KEGG   Felis catus (domestic cat): 493943Help
Entry
493943            CDS       T02385                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca01524  Platinum drug resistance
fca04012  ErbB signaling pathway
fca04066  HIF-1 signaling pathway
fca04068  FoxO signaling pathway
fca04110  Cell cycle
fca04115  p53 signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04218  Cellular senescence
fca04630  Jak-STAT signaling pathway
fca04921  Oxytocin signaling pathway
fca04928  Parathyroid hormone synthesis, secretion and action
fca04934  Cushing syndrome
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05203  Viral carcinogenesis
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05210  Colorectal cancer
fca05211  Renal cell carcinoma
fca05212  Pancreatic cancer
fca05213  Endometrial cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05216  Thyroid cancer
fca05217  Basal cell carcinoma
fca05218  Melanoma
fca05219  Bladder cancer
fca05220  Chronic myeloid leukemia
fca05222  Small cell lung cancer
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    493943 (CDKN1A)
   04630 Jak-STAT signaling pathway
    493943 (CDKN1A)
   04066 HIF-1 signaling pathway
    493943 (CDKN1A)
   04068 FoxO signaling pathway
    493943 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    493943 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    493943 (CDKN1A)
   04115 p53 signaling pathway
    493943 (CDKN1A)
   04218 Cellular senescence
    493943 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    493943 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    493943 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493943 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    493943 (CDKN1A)
   05206 MicroRNAs in cancer
    493943 (CDKN1A)
   05205 Proteoglycans in cancer
    493943 (CDKN1A)
   05203 Viral carcinogenesis
    493943 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    493943 (CDKN1A)
   05212 Pancreatic cancer
    493943 (CDKN1A)
   05225 Hepatocellular carcinoma
    493943 (CDKN1A)
   05226 Gastric cancer
    493943 (CDKN1A)
   05214 Glioma
    493943 (CDKN1A)
   05216 Thyroid cancer
    493943 (CDKN1A)
   05220 Chronic myeloid leukemia
    493943 (CDKN1A)
   05217 Basal cell carcinoma
    493943 (CDKN1A)
   05218 Melanoma
    493943 (CDKN1A)
   05211 Renal cell carcinoma
    493943 (CDKN1A)
   05219 Bladder cancer
    493943 (CDKN1A)
   05215 Prostate cancer
    493943 (CDKN1A)
   05213 Endometrial cancer
    493943 (CDKN1A)
   05224 Breast cancer
    493943 (CDKN1A)
   05222 Small cell lung cancer
    493943 (CDKN1A)
   05223 Non-small cell lung cancer
    493943 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    493943 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    493943 (CDKN1A)
   05161 Hepatitis B
    493943 (CDKN1A)
   05160 Hepatitis C
    493943 (CDKN1A)
   05163 Human cytomegalovirus infection
    493943 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    493943 (CDKN1A)
   05169 Epstein-Barr virus infection
    493943 (CDKN1A)
   05165 Human papillomavirus infection
    493943 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    493943 (CDKN1A)
   01522 Endocrine resistance
    493943 (CDKN1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CDI
Motif
Other DBs
NCBI-GeneID: 493943
NCBI-ProteinID: NP_001009865
Ensembl: ENSFCAG00000027886
UniProt: O19002
Position
B2
AA seq 164 aa AA seqDB search
MSEPSRDAHQIPHGSKACRRLFGPVDSEQLRRDCDALMAGCVQEARERWNFDFVTETPLE
GDFAWERVWGLGLPKLYLPAGPRGGRDDLGGGKRPSTSSTLLPGTAREDHLDLSLSCTLM
PHSPERPEASPGAPGTSQGRKRRQTSMTDFYHSKRRLIFSKRKP
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagccgtccagggatgcccaccagatcccacatggcagcaaggcctgccgccgc
ctcttcggcccagtggacagcgagcagctgcgccgagactgtgacgcgttaatggcaggc
tgcgtgcaggaggcccgggagcgatggaacttcgactttgtcaccgagacaccgctggag
ggcgactttgcctgggagcgtgtgtggggcctgggcctgcccaagctctacctgcctgca
gggccccgggggggccgggatgacctgggagggggcaagcggcccagcacctcgtctacc
ctgctgccggggacagctcgggaggaccacctggacctgtccctgtcctgcactctcatg
cctcactcccctgagcggcccgaggcgtctccgggtgcacctggcacctctcagggccga
aaacggcggcagaccagcatgacagatttctatcactccaaacgccggctgatcttctcc
aagaggaagccctaa

DBGET integrated database retrieval system