KEGG   Felis catus (domestic cat): 493945Help
Entry
493945            CDS       T02385                                 

Gene name
FASLG
Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
fca  Felis catus (domestic cat)
Pathway
fca01524  Platinum drug resistance
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04060  Cytokine-cytokine receptor interaction
fca04068  FoxO signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04210  Apoptosis
fca04217  Necroptosis
fca04650  Natural killer cell mediated cytotoxicity
fca04722  Neurotrophin signaling pathway
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca04940  Type I diabetes mellitus
fca05142  Chagas disease (American trypanosomiasis)
fca05143  African trypanosomiasis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05168  Herpes simplex virus 1 infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05320  Autoimmune thyroid disease
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    493945 (FASLG)
   04010 MAPK signaling pathway
    493945 (FASLG)
   04068 FoxO signaling pathway
    493945 (FASLG)
   04151 PI3K-Akt signaling pathway
    493945 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493945 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    493945 (FASLG)
   04217 Necroptosis
    493945 (FASLG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    493945 (FASLG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    493945 (FASLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493945 (FASLG)
   05205 Proteoglycans in cancer
    493945 (FASLG)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    493945 (FASLG)
   05330 Allograft rejection
    493945 (FASLG)
   05332 Graft-versus-host disease
    493945 (FASLG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    493945 (FASLG)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    493945 (FASLG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    493945 (FASLG)
   05162 Measles
    493945 (FASLG)
   05164 Influenza A
    493945 (FASLG)
   05161 Hepatitis B
    493945 (FASLG)
   05160 Hepatitis C
    493945 (FASLG)
   05168 Herpes simplex virus 1 infection
    493945 (FASLG)
   05163 Human cytomegalovirus infection
    493945 (FASLG)
   05165 Human papillomavirus infection
    493945 (FASLG)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    493945 (FASLG)
   05143 African trypanosomiasis
    493945 (FASLG)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    493945 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    493945 (FASLG)
   04052 Cytokines and growth factors [BR:fca04052]
    493945 (FASLG)
   04090 CD molecules [BR:fca04090]
    493945 (FASLG)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   493945 (FASLG)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Tumor necrosis fators
   493945 (FASLG)
CD molecules [BR:fca04090]
 Proteins
  493945 (FASLG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 493945
NCBI-ProteinID: NP_001009352
Ensembl: ENSFCAG00000005849
UniProt: Q861W5
Position
F1
AA seq 280 aa AA seqDB search
MQQPLNYPYPQIYWVDSRASSPWGPPGSVLPCPSSVPGRPGQRRPPPPPPPTLPPPPPPP
PLPPLPLPPLKTRRDHNTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQK
HVASSLEKQIGQLNPPSEKRELRKVAHLTGKPNSRSIPLEWEDTYGIALVSGVKYKKGGL
VINDTGMYFVYSKVNFRGQSCNNQPLNHKVYMRNSKYPQDLVLMEGKMMNYCTTGQMWAR
SSYLGAVFNLTSADHLYVNVSELSLVSFEESKTFFGLYKL
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagcccctgaattacccatacccccaaatctactgggtggacagcagggccagt
tctccctggggccctccagggtcggtcctcccttgtccatcctctgtgccaggaaggcct
ggacaaaggaggccgccaccgccgccaccaccaacactaccaccaccgccaccaccacca
ccactgcccccactgccattgccacctctgaagacgaggagggaccacaacacagggctg
tgtcttcttgtgatgtttttcatggttctggtggccctggttggactggggctggggatg
tttcagctcttccacctccagaaggagctggctgaactcagagagtccaccagccaaaag
catgtagcatcatctttggagaagcaaataggtcaactcaatccaccctctgaaaaaagg
gagctgagaaaagtggcccatttaacaggcaagcccaactcaagatccatccctctggaa
tgggaagacacatatggaattgcccttgtctctggggtgaagtataagaagggtggcctt
gtgatcaatgacactgggatgtactttgtatattccaaagtgaacttcaggggtcagtcc
tgcaacaaccaacccctgaaccacaaggtctacatgaggaactctaagtatccccaggac
ctggtgctgatggaagggaagatgatgaactactgcactactggccagatgtgggcccgc
agcagctacctgggggcagtattcaatctcaccagtgctgaccatttatatgtcaatgta
tctgaattatctctggtcagttttgaggaatctaagacattttttggcttatataaactc
taa

DBGET integrated database retrieval system