KEGG   Felis catus (domestic cat): 493947Help
Entry
493947            CDS       T02385                                 

Gene name
MAX
Definition
(RefSeq) protein max
  KO
K04453  Max protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    493947 (MAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493947 (MAX)
   05202 Transcriptional misregulation in cancer
    493947 (MAX)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    493947 (MAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    493947 (MAX)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Mad/Max
    493947 (MAX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH Filament SlyX bZIP_2 Rab5-bind CREPT DUF5082 SLX9 DUF5595 ZapB DUF4763 ATG16 Csm1_N DivIC V_ATPase_I
Motif
Other DBs
NCBI-GeneID: 493947
NCBI-ProteinID: NP_001009866
Ensembl: ENSFCAG00000010347
UniProt: P61245
Position
B3
AA seq 160 aa AA seqDB search
MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR
AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN
SLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct
gcggctgacaaacgggctcatcataacgcactggaacgaaaacgtagggaccacatcaaa
gacagctttcacagtttgcgggactcggtcccatcactccaaggagagaaggcatcccgg
gcccaaatcctagacaaagccacagagtatatccagtatatgcgaaggaaaaaccacaca
caccagcaagatatcgatgacctcaagcggcagaatgctctcctggagcagcaagtccgt
gcactggagaaggcgaggtcgagtgcccaactgcagaccaactacccctcctcagacaac
agcctctacaccaacgccaagggcagcaccatctctgccttcgatggaggctcagactcc
agctcggagtcggagcccgaagagccccaaagcaggaagaagctccggatggaggccagc
taa

DBGET integrated database retrieval system