KEGG   Felis catus (domestic cat): 493957Help
Entry
493957            CDS       T02385                                 

Gene name
TNFRSF1A
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 1A precursor
  KO
K03158  tumor necrosis factor receptor superfamily member 1A
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04060  Cytokine-cytokine receptor interaction
fca04064  NF-kappa B signaling pathway
fca04071  Sphingolipid signaling pathway
fca04150  mTOR signaling pathway
fca04210  Apoptosis
fca04215  Apoptosis - multiple species
fca04217  Necroptosis
fca04380  Osteoclast differentiation
fca04668  TNF signaling pathway
fca04920  Adipocytokine signaling pathway
fca04931  Insulin resistance
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05014  Amyotrophic lateral sclerosis (ALS)
fca05142  Chagas disease (American trypanosomiasis)
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05170  Human immunodeficiency virus 1 infection
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    493957 (TNFRSF1A)
   04064 NF-kappa B signaling pathway
    493957 (TNFRSF1A)
   04668 TNF signaling pathway
    493957 (TNFRSF1A)
   04071 Sphingolipid signaling pathway
    493957 (TNFRSF1A)
   04150 mTOR signaling pathway
    493957 (TNFRSF1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493957 (TNFRSF1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    493957 (TNFRSF1A)
   04215 Apoptosis - multiple species
    493957 (TNFRSF1A)
   04217 Necroptosis
    493957 (TNFRSF1A)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    493957 (TNFRSF1A)
  09158 Development
   04380 Osteoclast differentiation
    493957 (TNFRSF1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    493957 (TNFRSF1A)
   05014 Amyotrophic lateral sclerosis (ALS)
    493957 (TNFRSF1A)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    493957 (TNFRSF1A)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    493957 (TNFRSF1A)
   04931 Insulin resistance
    493957 (TNFRSF1A)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    493957 (TNFRSF1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    493957 (TNFRSF1A)
   05170 Human immunodeficiency virus 1 infection
    493957 (TNFRSF1A)
   05164 Influenza A
    493957 (TNFRSF1A)
   05160 Hepatitis C
    493957 (TNFRSF1A)
   05168 Herpes simplex virus 1 infection
    493957 (TNFRSF1A)
   05163 Human cytomegalovirus infection
    493957 (TNFRSF1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    493957 (TNFRSF1A)
   05165 Human papillomavirus infection
    493957 (TNFRSF1A)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    493957 (TNFRSF1A)
   05142 Chagas disease (American trypanosomiasis)
    493957 (TNFRSF1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    493957 (TNFRSF1A)
   04090 CD molecules [BR:fca04090]
    493957 (TNFRSF1A)
Cytokine receptors [BR:fca04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   493957 (TNFRSF1A)
CD molecules [BR:fca04090]
 Proteins
  493957 (TNFRSF1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 Death
Motif
Other DBs
NCBI-GeneID: 493957
NCBI-ProteinID: NP_001009361
Ensembl: ENSFCAG00000006868
UniProt: Q95ND3
Position
B4
AA seq 446 aa AA seqDB search
MGLPTVPGLLQPLVLLALLVEIYPLRVTGLVPHLRDREKRAIPCPQGKYIHPQDNSICCT
KCHKGTYLYNDCAGPGLDTDCRECENGTFTASENYLRQCLSCSKCRKEMYQVEISPCTVY
RDTVCGCRKNQYRYYWSETHFQCLNCSLCLNGTVQISCKETQNTVCTCHAGFFLRGNECV
SCVNCKKNTECTKLCVPIVETVKDPQDPGTTVLLPLVIFFGICVLSFSIGLMCRYQRRKS
KLFSIVCGKSTPTKEGEPQPLATGPGFSPIPSPTFSPSPTFTPSPTFTPSDWANLRAASV
SREMAPPYQGAGPILSAAPASSPISTPVQKWEDSTHTQRPEADPADPATLYAVVDGVPPS
RWKEFVRRLGLSEHEIERLELQNGRCLREAHYSMLAAWRRRTPRREATLELLGRVLRDMD
LLGCLEDIEEALCAPASLSPAPRLLR
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgggcctccccaccgtccctggcctgctgcagccactggtacttctggctctgttggtg
gaaatatacccattaagggttactggactggtccctcacctcagggaccgggagaagaga
gctattccatgtccccaaggaaaatatattcaccctcaagataattccatttgctgtacg
aagtgccacaaagggacctacctgtacaatgactgtgcgggcccagggctggacacggac
tgcagagaatgtgaaaatggcacatttactgcttcagagaactacctcagacagtgcctt
agctgctccaaatgccgaaaagaaatgtaccaggtggagatatctccttgcacagtgtac
cgggacaccgtgtgtggctgcaggaagaaccagtaccggtattactggagtgaaacccat
ttccagtgcctaaactgcagcctctgcctcaacggcacggtgcagatctcctgcaaggag
acacagaatactgtatgcacctgccacgcggggttctttcttagagggaatgaatgcgtc
tcttgtgttaactgtaagaaaaacacagagtgtacgaagttgtgcgtacccatcgtggaa
actgttaaggaccctcaggacccaggcaccacagtgctgctgcctctcgtgatcttcttc
ggcatttgcgttttatccttctccattggtttaatgtgccgctaccaacggcggaagtcc
aagctcttctccattgtttgtgggaaatcaacacctacaaaagagggagagcctcagccc
ctggccacaggtccaggcttcagtcccatccccagccccaccttcagccccagccccacc
ttcactcccagccccaccttcactcctagcgactgggctaatttgagggctgcatccgtc
tccagagagatggctccaccctaccagggggctggccccatcctctccgcggctccagcc
tccagccccatctccaccccagttcagaagtgggaggacagcacccacactcaacgccca
gaagcggatcccgccgacccggcgacgctgtacgcggtggtggacggcgtgcccccgtcg
cgctggaaggagttcgtgcggcggctggggctgagcgagcacgagatcgagcggctggag
ctgcagaacgggcgctgcctgcgcgaggcgcactacagcatgctggcggcctggcggcga
cgcacgccacgacgcgaagccacgctggagctgctgggccgcgtgctccgtgacatggac
ctgctcggctgcctggaggacatcgaggaggcgctgtgcgcccccgcctccctgtcgccc
gcgccccgcctcctccggtga

DBGET integrated database retrieval system