KEGG   Felis catus (domestic cat): 493958Help
Entry
493958            CDS       T02385                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04012  ErbB signaling pathway
fca04066  HIF-1 signaling pathway
fca04068  FoxO signaling pathway
fca04110  Cell cycle
fca04151  PI3K-Akt signaling pathway
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04934  Cushing syndrome
fca05162  Measles
fca05165  Human papillomavirus infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05203  Viral carcinogenesis
fca05206  MicroRNAs in cancer
fca05215  Prostate cancer
fca05220  Chronic myeloid leukemia
fca05222  Small cell lung cancer
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    493958 (CDKN1B)
   04066 HIF-1 signaling pathway
    493958 (CDKN1B)
   04068 FoxO signaling pathway
    493958 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    493958 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    493958 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493958 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    493958 (CDKN1B)
   05206 MicroRNAs in cancer
    493958 (CDKN1B)
   05203 Viral carcinogenesis
    493958 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    493958 (CDKN1B)
   05220 Chronic myeloid leukemia
    493958 (CDKN1B)
   05215 Prostate cancer
    493958 (CDKN1B)
   05222 Small cell lung cancer
    493958 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    493958 (CDKN1B)
   04934 Cushing syndrome
    493958 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    493958 (CDKN1B)
   05169 Epstein-Barr virus infection
    493958 (CDKN1B)
   05165 Human papillomavirus infection
    493958 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    493958 (CDKN1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CDI
Motif
Other DBs
NCBI-GeneID: 493958
NCBI-ProteinID: NP_001009870
Ensembl: ENSFCAG00000022816
UniProt: O19001
Position
B4
AA seq 198 aa AA seqDB search
MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGNRQAVPLIG
SQANTEDTHLVDQKTDTSDNQTGLAEQCPGIRKRPATDDSSPQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagcccgagcttggagcggatggacgccagacag
gcggagtaccccaagccctccgcctgcaggaacctcttcggcccggtcaaccacgaagag
ttgacccgggacttggagaagcactgcagagacatggaagaggcaagccagcgcaagtgg
aattttgatttccagaatcacaagcccctggagggcaaatacgagtggcaagaggtggaa
aagggcagcttgcccgagttctactacagacccccgcggccacccaaaggcgcctgcaag
gtgccggcgcaggagagccaggatgtcagcgggaaccgccaggcggtgcctttaattggg
tctcaggcaaacacagaggacacacatttggtagaccaaaagactgatacatcggacaac
cagacggggttagcggagcagtgccctgggataaggaagcgacctgctacagatgattcc
tctcctcaaaacaaaagagccaacagaacagaagaaaatgtctcagacggttccccgaac
gctggttcagtggagcagacgcccaagaagcctggcctgagaagacgtcaaacgtaa

DBGET integrated database retrieval system