KEGG   Felis catus (domestic cat): 493965Help
Entry
493965            CDS       T02385                                 

Gene name
IFNG
Definition
(RefSeq) interferon gamma precursor
  KO
K04687  interferon gamma
Organism
fca  Felis catus (domestic cat)
Pathway
fca03050  Proteasome
fca04060  Cytokine-cytokine receptor interaction
fca04066  HIF-1 signaling pathway
fca04217  Necroptosis
fca04350  TGF-beta signaling pathway
fca04380  Osteoclast differentiation
fca04612  Antigen processing and presentation
fca04630  Jak-STAT signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04657  IL-17 signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04940  Type I diabetes mellitus
fca05132  Salmonella infection
fca05140  Leishmaniasis
fca05142  Chagas disease (American trypanosomiasis)
fca05143  African trypanosomiasis
fca05144  Malaria
fca05145  Toxoplasmosis
fca05146  Amoebiasis
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05164  Influenza A
fca05168  Herpes simplex virus 1 infection
fca05200  Pathways in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05321  Inflammatory bowel disease (IBD)
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    493965 (IFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    493965 (IFNG)
   04630 Jak-STAT signaling pathway
    493965 (IFNG)
   04066 HIF-1 signaling pathway
    493965 (IFNG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493965 (IFNG)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    493965 (IFNG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    493965 (IFNG)
   04612 Antigen processing and presentation
    493965 (IFNG)
   04660 T cell receptor signaling pathway
    493965 (IFNG)
   04658 Th1 and Th2 cell differentiation
    493965 (IFNG)
   04659 Th17 cell differentiation
    493965 (IFNG)
   04657 IL-17 signaling pathway
    493965 (IFNG)
  09158 Development
   04380 Osteoclast differentiation
    493965 (IFNG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493965 (IFNG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    493965 (IFNG)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    493965 (IFNG)
   05323 Rheumatoid arthritis
    493965 (IFNG)
   05321 Inflammatory bowel disease (IBD)
    493965 (IFNG)
   05330 Allograft rejection
    493965 (IFNG)
   05332 Graft-versus-host disease
    493965 (IFNG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    493965 (IFNG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    493965 (IFNG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    493965 (IFNG)
   05152 Tuberculosis
    493965 (IFNG)
  09172 Infectious disease: viral
   05164 Influenza A
    493965 (IFNG)
   05160 Hepatitis C
    493965 (IFNG)
   05168 Herpes simplex virus 1 infection
    493965 (IFNG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    493965 (IFNG)
   05144 Malaria
    493965 (IFNG)
   05145 Toxoplasmosis
    493965 (IFNG)
   05140 Leishmaniasis
    493965 (IFNG)
   05142 Chagas disease (American trypanosomiasis)
    493965 (IFNG)
   05143 African trypanosomiasis
    493965 (IFNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:fca03051]
    493965 (IFNG)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    493965 (IFNG)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    493965 (IFNG)
Proteasome [BR:fca03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    493965 (IFNG)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Interferons
   493965 (IFNG)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate/Haparin
  Cytokines
   493965 (IFNG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IFN-gamma
Motif
Other DBs
NCBI-GeneID: 493965
NCBI-ProteinID: NP_001009873
Ensembl: ENSFCAG00000009014
UniProt: P46402 A9UKW5
Position
B4
AA seq 167 aa AA seqDB search
MNYTSFIFAFQLCIILCSSGYYCQAMFFKEIEELKGYFNASNPDVADGGSLFVDILKNWK
EESDKTIIQSQIVSFYLKMFENLKDDDQRIQRSMDTIKEDMLDKLLNTSSSKRDDFLKLI
QIPVNDLQVQRKAINELFKVMNDLSPRSNLRKRKRSQNLFRGRRASK
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgaattacacaagttttattttcgctttccagctttgcataattttgtgttcttctggt
tattactgtcaggccatgttttttaaagaaatagaagagctaaagggatattttaatgca
agtaatccagatgtagcagatggtgggtcgcttttcgtagacattttgaagaactggaaa
gaggagagtgataaaacaataattcaaagccaaattgtctccttctacctgaaaatgttt
gaaaacctgaaagatgatgaccagcgcattcaaaggagcatggacaccatcaaggaagac
atgcttgataagttgttaaataccagctccagtaaacgggatgacttcctcaagctgatt
caaatccctgtgaatgatctgcaggtccagcgcaaagcaataaatgaactcttcaaagtg
atgaatgatctctcaccaagatctaacctgaggaagcggaaaaggagccagaatctgttt
cgaggccgtagagcatcgaaataa

DBGET integrated database retrieval system