KEGG   Felis catus (domestic cat): 724036Help
Entry
724036            CDS       T02385                                 

Gene name
TNFSF11
Definition
(RefSeq) tumor necrosis factor ligand superfamily member 11
  KO
K05473  tumor necrosis factor ligand superfamily member 11
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04064  NF-kappa B signaling pathway
fca04380  Osteoclast differentiation
fca04917  Prolactin signaling pathway
fca04928  Parathyroid hormone synthesis, secretion and action
fca05224  Breast cancer
fca05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    724036 (TNFSF11)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    724036 (TNFSF11)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    724036 (TNFSF11)
   04928 Parathyroid hormone synthesis, secretion and action
    724036 (TNFSF11)
  09158 Development
   04380 Osteoclast differentiation
    724036 (TNFSF11)
 09160 Human Diseases
  09162 Cancer: specific types
   05224 Breast cancer
    724036 (TNFSF11)
  09163 Immune disease
   05323 Rheumatoid arthritis
    724036 (TNFSF11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    724036 (TNFSF11)
   04090 CD molecules [BR:fca04090]
    724036 (TNFSF11)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Tumor necrosis fators
   724036 (TNFSF11)
CD molecules [BR:fca04090]
 Proteins
  724036 (TNFSF11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 724036
NCBI-ProteinID: XP_023107641
Ensembl: ENSFCAG00000005912
Position
A1
AA seq 321 aa AA seqDB search
MRRASRDYTKYLRGSEEMGGGGPGAPHEGPLHAPPPPAPPAPHPPAAASRSMFVAFLGLG
LGQVVCSVALFLYFRAQMDPNRISEDDTHCINRIFKLHENADLQDTTLESQDTKLIPDSC
KSIKQAFRAAVQKELQHLVRSQHIRAEKAMMEGSWLELARRGKPDTQPFAHLTINATDIP
SGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYFLYANICFRHHETSGDLATEYL
QLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNP
SLLDPDQDATYFGAFKVLDID
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcgccagccgagactacaccaagtacctgcgcggctcggaggagatgggcggc
ggcggccccggcgccccgcacgagggccccctgcacgccccgccgccgcccgcgccgccc
gcgccgcacccgcccgccgccgcctcgcgctccatgttcgtggccttcctgggactgggg
ctgggccaggtggtctgcagcgtcgccctgttcctctacttcagagcgcagatggatcct
aatagaatatcggaagatgacactcactgcattaatagaattttcaaactccacgaaaac
gcagatttgcaagacacaactctggagagtcaagacacaaaattaatacctgattcgtgt
aagagcattaaacaggccttccgggcagctgtacaaaaggaattacaacatctagttaga
tcacaacacatcagagcagagaaagctatgatggaaggttcatggctagaactggccagg
aggggcaagcctgatacccagccttttgctcatctcactattaatgccactgacatccca
tcaggttcccacaaagtgagcctgtcctcctggtaccatgaccgaggttgggccaagatc
tccaacatgactttcagcaatggaaaactaatagttaaccaagatggcttttatttcctg
tatgccaacatttgctttcgacatcatgaaacttcgggagacctcgccacagagtatctt
cagctgatggtgtatgtcactaaaaccagcatcaaaatcccgagctctcataccctgatg
aaaggaggtagcaccaaatactggtcagggaattctgaattccatttttattccataaat
gttggaggattttttaagctacggtctggtgaggaaataagcatcgaggtatccaaccct
tcactactggatccagatcaagatgcaacatactttggggcttttaaagttctagatata
gattga

DBGET integrated database retrieval system