KEGG   Felis catus (domestic cat): 751114Help
Entry
751114            CDS       T02385                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2 precursor
  KO
K05429  interleukin 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04151  PI3K-Akt signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04630  Jak-STAT signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05142  Chagas disease (American trypanosomiasis)
fca05162  Measles
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease (IBD)
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    751114 (IL2)
   04151 PI3K-Akt signaling pathway
    751114 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    751114 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    751114 (IL2)
   04660 T cell receptor signaling pathway
    751114 (IL2)
   04658 Th1 and Th2 cell differentiation
    751114 (IL2)
   04659 Th17 cell differentiation
    751114 (IL2)
   04672 Intestinal immune network for IgA production
    751114 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    751114 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    751114 (IL2)
   05321 Inflammatory bowel disease (IBD)
    751114 (IL2)
   05330 Allograft rejection
    751114 (IL2)
   05332 Graft-versus-host disease
    751114 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    751114 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    751114 (IL2)
   05162 Measles
    751114 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    751114 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    751114 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    751114 (IL2)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Interleukins
   751114 (IL2)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate/Haparin
  Cytokines
   751114 (IL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL2 Aromatic_hydrox
Motif
Other DBs
NCBI-GeneID: 751114
NCBI-ProteinID: NP_001036802
Ensembl: ENSFCAG00000013688
UniProt: Q07885
Position
B1
AA seq 154 aa AA seqDB search
MYKIQLLSCIALTLILVTNSAPASSSTKETQQQLEQLLLDLRLLLNGVNNPENPKLSRML
TFKFYVPKKATELTHLQCLVEELKPLEEVLYLAQSKNFHLNHIKELMSNINVTVLKLKGS
ETRFTCNYDDETATIVEFLNKWITFCQSIFSTLT
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaaattcaactcttgtcttgcattgcactgactcttatactcgtcacaaacagt
gcacctgcttcaagctctacaaaggaaacacagcaacagctggagcaattactgctggat
ttacggttgcttttgaatggagttaataatcctgagaaccccaaactctccaggatgctc
acatttaaattttacgtgcccaagaaggccacagaattgacacatcttcagtgtctagta
gaagaactcaaacctctggaggaagtgctatatttagctcaaagcaaaaactttcacttg
aatcacatcaaggaattaatgagcaatatcaatgtaacagttctgaaactaaagggatct
gaaacaagattcacatgtaactatgatgatgagacagcaaccattgtagaatttctgaac
aaatggattaccttttgtcaaagcatcttctcaacgctgacttga

DBGET integrated database retrieval system