KEGG   Felis catus (domestic cat): 751824Help
Entry
751824            CDS       T02385                                 

Gene name
ERBB2
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-2 precursor
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca01524  Platinum drug resistance
fca04010  MAPK signaling pathway
fca04012  ErbB signaling pathway
fca04020  Calcium signaling pathway
fca04066  HIF-1 signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04520  Adherens junction
fca04530  Tight junction
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05212  Pancreatic cancer
fca05213  Endometrial cancer
fca05215  Prostate cancer
fca05219  Bladder cancer
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05226  Gastric cancer
fca05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    751824 (ERBB2)
   04012 ErbB signaling pathway
    751824 (ERBB2)
   04066 HIF-1 signaling pathway
    751824 (ERBB2)
   04020 Calcium signaling pathway
    751824 (ERBB2)
   04151 PI3K-Akt signaling pathway
    751824 (ERBB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    751824 (ERBB2)
   04520 Adherens junction
    751824 (ERBB2)
   04530 Tight junction
    751824 (ERBB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    751824 (ERBB2)
   05206 MicroRNAs in cancer
    751824 (ERBB2)
   05205 Proteoglycans in cancer
    751824 (ERBB2)
   05230 Central carbon metabolism in cancer
    751824 (ERBB2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    751824 (ERBB2)
   05226 Gastric cancer
    751824 (ERBB2)
   05219 Bladder cancer
    751824 (ERBB2)
   05215 Prostate cancer
    751824 (ERBB2)
   05213 Endometrial cancer
    751824 (ERBB2)
   05224 Breast cancer
    751824 (ERBB2)
   05223 Non-small cell lung cancer
    751824 (ERBB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    751824 (ERBB2)
   01524 Platinum drug resistance
    751824 (ERBB2)
   01522 Endocrine resistance
    751824 (ERBB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    751824 (ERBB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    751824 (ERBB2)
   04090 CD molecules [BR:fca04090]
    751824 (ERBB2)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     751824 (ERBB2)
Protein kinases [BR:fca01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   751824 (ERBB2)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   751824 (ERBB2)
CD molecules [BR:fca04090]
 Proteins
  751824 (ERBB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain GF_recep_IV Pkinase Furin-like Haspin_kinase APH CBP_BcsF
Motif
Other DBs
NCBI-GeneID: 751824
NCBI-ProteinID: NP_001041628
Ensembl: ENSFCAG00000009903
UniProt: Q49LT4
Position
E1
AA seq 1260 aa AA seqDB search
MELAAWCRWGLLLALLPSGATGTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNL
ELTYLHANASLSFLQDIQEVQGYVLIAHNQVKQVPLQRLRIVRGTQLFEDNYALAVLDNG
DPLKNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLA
LTLIDTNRSRACHPCSPMCEGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQC
AAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACP
YNYLSTDVGSCTLVCPLNNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREARAVTSAN
IQEFVGCKKIFGSLAFLPGSFEGDPASNTAPLQPEQLRVFEALEEITGYLYISAWPDSLP
NLSVFQNLRVIRGRVLHDGAYSLTLQGLGISWLGLRSLRELGSGLALIHRNSRLCFVHTV
PWDQLFRNPHQALLHSANRPEDECPGEGLACYPLCAHGHCWGPGPTHCVNCSQFLPGQEC
VEECRVLQGLPREYVKDRFCLPCHPECQPQNGSVTCLGSEADQCVACAHYKDPPFCVARC
SSGVKPDLSFMPIWKFADEEGTCQPCPINCTHSCADLDEKGCPAEQRASPVTSIIAAVVG
ILLVVVVGLVLGILIKRRRQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETEL
RKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSP
YVSRLLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYLEDVR
LVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFT
HQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWM
IDSECRPRFRELVAEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDEDMGDLVDA
EEYLVPQQGFFCPDPAPGAGGTAHRRHRSSSTRSGGGELTLGLEPSEEEPPKSPLAPSEG
AGSDVFDGDLGMGAAKGLQSLSPQDPSPLQRYSEDPTVPLPPETDGYVAPLTCSPQPEYV
NQPEVWPKPPSPLEGPLPPSRPAGATLERPKTLSPKTLSPGKNGVVKDVFAFGGAVENPE
YLAPRGRAAPQPHPPPAFSPAFDNLYYWDQDTSERGSPPSTFEGTPTAENPEYLGLDVPV
NT seq 3783 nt NT seq  +upstreamnt  +downstreamnt
atggagctggcggcctggtgccgctgggggctcctcctcgccctcctgccctccggagcc
acgggcacccaagtgtgcaccggcacagacatgaagctgcggctcccagccagtcccgag
acccacctggacatgctccgccacctctaccagggctgtcaagtggtacagggcaacctg
gagctcacctacctgcatgccaatgccagcctctccttcctgcaggatatccaggaggtg
caaggctatgtgctcattgcccacaaccaagtgaaacaggtcccactgcagaggctacga
atcgtgcgaggcacccagctctttgaggacaactacgccctggccgtgctggacaatgga
gacccgctgaagaataccacccctgtcacaggggcctccccaggaggcctgcgggagctg
cagcttcgaagcctcacagagatcttgaaaggaggggtcttgatccagcggaacccccag
ctctgctaccaggacacgattttgtggaaggacatcttccacaagaacaaccagctggct
ctcacactgatagacaccaaccgctctcgggcctgccacccctgttctccgatgtgtgag
ggctcccgctgctggggagagagttctgaggattgtcagagcctgacgcgcactgtctgt
gccggtggctgtgcccgctgcaaggggccactgcccactgactgctgccatgagcagtgt
gctgccggctgcacgggccccaagcactctgactgcctggcctgcctccacttcaaccac
agtggcatctgtgagctgcactgcccagccctggtcacctacaacacagacacgtttgag
tccatgcccaatcccgagggccggtatacattcggcgccagctgtgtgactgcctgtccc
tacaactacctttctacggacgtgggatcctgcaccctggtctgtcccctgaacaaccaa
gaggtgacagctgaggatggaacacagcggtgtgagaaatgcagcaagccctgtgcccga
gtgtgctacggcctaggcatggagcacctgcgggaggcgagggcagtcaccagtgccaac
atccaagaatttgtcggctgcaagaagatctttgggagcctggcgtttctgccagggagc
tttgagggggacccagcctccaacactgcccccctgcagcctgagcagctcagagtgttt
gaggctctggaggagattacaggttacctgtacatctcagcgtggccagacagcttgcct
aacctcagtgtcttccagaacctcagagtaatccggggccgagttctgcatgacggtgct
tactcgctgacccttcaagggctgggcatcagctggctggggctgcgctcgctgcgggag
ctgggcagtgggctggccctcatccaccgcaactcccgcctctgcttcgtacacacggtg
ccctgggaccagctcttccggaacccccaccaggccctgctccacagcgccaaccggcca
gaggacgagtgcccgggtgagggcctggcctgctatccgctgtgcgcccacgggcactgc
tggggtccgggacccacccattgtgtcaactgcagccagttccttccgggccaggaatgc
gtggaggaatgccgagtactgcaggggctgccccgggagtatgtgaaggataggttctgt
ctgccatgccacccggagtgtcagccccagaatggctcagtgacctgcttgggctcggaa
gctgaccagtgtgtggcctgtgcccactacaaggaccctcctttctgtgtggctcgctgc
tccagtggggtgaaacctgacctctccttcatgcccatctggaagttcgcagatgaggag
ggcacgtgccagccatgccccatcaactgcacccactcctgtgcggacctggacgagaag
ggctgccccgccgagcagagagccagccctgtgacgtccatcattgccgctgtggtgggc
attctgctggtcgtggttgtggggctggtccttggcatcctgatcaagcgaaggcggcag
aagatccggaagtacacgatgcggaggctgctgcaggagacggagctggtggagcccctg
acgcctagtggagccatgcccaaccaggctcagatgcgaatcctgaaagaaacagagctg
aggaaggtgaaggtgcttggatccggagcttttggcactgtctacaagggcatctggatc
cctgacggggaaaatgtgaaaatcccagtggccatcaaagtgttgagggaaaatacatct
cccaaagccaacaaagaaatcttggacgaagcgtatgtgatggctggcgtgggctcccca
tatgtgtctcgccttctgggcatctgcctgacatccacggtgcagttggtgacacagctt
atgccttatggctgcctcttagaccatgtccgagaacaccgtgggcgcctaggctcccag
gacctgctgaactggtgtgtgcagattgccaaggggatgagctacttggaggatgttcgg
ctcgtgcacagggacctggctgcccggaacgtgctggtcaagagtcccaaccacgtcaag
attacagattttgggctggctcggctgctggacattgacgagacagagtaccatgccgat
gggggcaaggtgcccatcaagtggatggcgctggagtccattctccgccggcggttcacc
catcagagtgacgtgtggagctacggtgtgactgtatgggaactgatgacttttggggcc
aaaccttatgatgggatcccagcccgggagattcctgacctgctggagaagggggaacgg
ctgccccagccccccatctgcaccattgatgtctacatgatcatggtcaaatgttggatg
atagactctgaatgtcggccacgtttccgggagctggtggccgaattctcccgtatggcc
agggacccccagcgctttgtggtcatccagaatgaggacttgggcccagcgagtcccttg
gacagcactttctaccgttcactgctggaggatgaggacatgggagacctggtggatgct
gaggagtacctggtaccccagcagggtttcttctgcccagaccctgccccaggcgctggg
ggcacagcccaccgcagacaccgcagctcatccaccaggagtggcggtggtgagctgaca
ctggggctggagccctccgaggaagagcctcccaagtctccactggcaccctcagaaggg
gctggctctgatgtgtttgatggcgacttgggaatgggggcagccaaggggctgcagagc
ctttccccacaggaccccagccctctacagcggtacagtgaggatcctaccgtaccccta
ccccctgagactgatggctacgttgcccccctgacctgcagtccccagcctgaatacgtg
aaccagccagaggtttggccaaagcccccatcgcccttagaaggccctctgcctccttct
cgacctgccggtgccactctggaaaggcccaagactctgtcccccaagactctttccccc
ggcaagaatggggttgtcaaagacgtttttgcctttgggggtgctgtggagaaccccgag
tacttggcaccccggggcagggctgcccctcagcctcaccctcctccagccttcagccca
gcctttgacaacctctattactgggaccaggacacatctgagcggggctctccacccagc
acctttgaagggacccctacagcagagaaccccgaatacctggggctggacgtgccagtg
tga

DBGET integrated database retrieval system