KEGG   Felis catus (domestic cat): 768257Help
Entry
768257            CDS       T02385                                 

Gene name
APAF1
Definition
(RefSeq) apoptotic protease-activating factor 1 isoform X1
  KO
K02084  apoptotic protease-activating factor
Organism
fca  Felis catus (domestic cat)
Pathway
fca01524  Platinum drug resistance
fca04115  p53 signaling pathway
fca04210  Apoptosis
fca04215  Apoptosis - multiple species
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis (ALS)
fca05016  Huntington disease
fca05134  Legionellosis
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05164  Influenza A
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05222  Small cell lung cancer
Module
fca_M00685  Apoptotic machinery
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    768257 (APAF1)
   04215 Apoptosis - multiple species
    768257 (APAF1)
   04115 p53 signaling pathway
    768257 (APAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    768257 (APAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    768257 (APAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    768257 (APAF1)
   05012 Parkinson disease
    768257 (APAF1)
   05014 Amyotrophic lateral sclerosis (ALS)
    768257 (APAF1)
   05016 Huntington disease
    768257 (APAF1)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    768257 (APAF1)
   05152 Tuberculosis
    768257 (APAF1)
  09172 Infectious disease: viral
   05162 Measles
    768257 (APAF1)
   05164 Influenza A
    768257 (APAF1)
   05161 Hepatitis B
    768257 (APAF1)
   05160 Hepatitis C
    768257 (APAF1)
   05168 Herpes simplex virus 1 infection
    768257 (APAF1)
   05169 Epstein-Barr virus infection
    768257 (APAF1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    768257 (APAF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 NB-ARC APAF1_C ANAPC4_WD40 CARD Ge1_WD40 eIF2A WD40_like CARD_2 AAA_16 Hira Utp8 NACHT AAA_22 AAA_18
Motif
Other DBs
NCBI-GeneID: 768257
NCBI-ProteinID: XP_019690929
Ensembl: ENSFCAG00000010807
UniProt: A0A337S9X3
Position
B4
AA seq 1250 aa AA seqDB search
MDAKARNCLLQHREALEKDIKTSYIMDRMINDGVLTVSEEEKVKNEPTQQQRAALLIKMI
LKKDNYSYISFYNALIHEGYKDLAGLLHGGIPVISSSNGGKDSVGGITSYVRTVLCEGGV
PQRPVVFVTRKKLVNSIQQNLFKLNGEPGWVIIYGMAGCGKSVLAAETVRDHSFLDGCFP
GGVHWVSVGKQDKSGLLMKLQNLCARLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSL
LILDDVWDPWVLKAFDNQCQILITTRDKSVTDSVMGPKYVVSVESGLGKEKGLEILSLFV
NMKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWDYYLRQLQNKQFKRIRKSSFY
DYEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDMETEEVEDILQEFV
NKSLLFCDRNGKSFCYYLHDLQVDFLIEKNRNQLQDLHKKLITQFQRHHQPHTLSPDQED
CMYWYNFLAYHMASANMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCA
VCENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYQQAKLQAKQEVDNGMLYLEWIN
KKNNKNLSRLVVRPHTDAVYHACFSEDGQRIASCGVDKTLQVFKAETGEKLLEIKAHEDE
VLCCAFSADDRFIATCSVDKKVKIWNSMTGELVHIYDEHSEQVNCCHFTNNSHHLLLATA
SSDCFLKLWDLTQKECRNTMFGHTNSVNHCRFSPDDKLLASCSADGTLKLWDVKSANERE
SINVKQFFLNSEEPQEDMEVIVKCCSWSADGASIMVAAKNKIFLFDIHASGLLAEIHTGH
HSTIQYCDFSPQNRLAVVALSQCCVELWNMDSCLKVADCRGHLSWVHCVMFSPDGSSFLT
SSDDQTIRLWETKKVCENSAIVLKQDIDVVFQENEVMVLAVDNVRHLQLINGKTGQTDYL
TEAQVSCCCLSPHLEYIAFGGEDGAIEILELLNNRIFQSRIGHKKTVRHIQFTDDGKTLI
SSSDDSSIQVWNWQSEEYVFLQAHQETVKDFRLLKNSRLLSWSFDGTVKVWSIITGRIEK
DFVCHQDTVLSCDISPDATKFSSTSADKTAKIWSFELLSPLHELRGHKGCVRCSAFSVDS
TLLATGDDNGEIRIWNVSNGELLHLCAPISVEEGAATHGGWVTDLCFSPDSKMLVSAGGY
LKWWSVDTGESSQIFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILQMLE
NT seq 3753 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaaaagctcgaaactgtttgcttcaacatagagaagccctggaaaaggacatt
aaaacgtcctacatcatggatcgtatgattaatgatggagttttaacagtatcagaggag
gaaaaagtaaaaaatgagcccactcagcagcaacgagcagctctcctaattaaaatgata
cttaaaaaagataattattcctacatatcattctacaatgctctaatacatgaagggtat
aaagatcttgctggccttcttcatggtggcattcctgtcatctcttcttcgaatggtggc
aaagattcagttggtggaataacttcatatgtaaggacagtcctgtgtgaaggtggagtg
ccacagaggccggtggtctttgttactaggaagaaactggtgaactcaattcagcagaac
ctcttcaaactaaatggtgaaccaggatgggtcatcatatacggaatggcaggttgtggg
aagtctgttttagcggcagaaactgttcgagatcattctttcttagacggttgtttccca
gggggtgtgcactgggtttcagttgggaaacaagacaagtctgggcttctgatgaaactg
cagaatctttgcgcacggttggatcaggatgagagtttctcccagaggcttccactcaat
attgaagaggctaaagaccgccttcgcattctgatgctgcgtaaacacccacggtctctg
ttgatcttggatgatgtttgggatccttgggtattaaaagcttttgacaatcagtgtcag
attcttattacaaccagagacaagagtgttacagattcagtaatgggtcctaaatatgta
gtctctgtggagagtggcttaggaaaagaaaaaggacttgaaattttatccctttttgtt
aatatgaagaaagcagatttgccagaacaagctcacagtattataaaagaatgtaaaggt
tctcctcttgtagtgtctttgattggtgcacttttacgtgattttcccaaccgttgggat
tactaccttaggcaacttcagaataagcaatttaagagaataaggaaatcttcattttat
gattatgaggctctggatgaagccatgtctataagcgttgaaatgctcagagaggacatc
aaagattattatacagatctttccatccttcagaaggatgttaaggtgcctacaaaggtg
ttatgtattctctgggacatggaaactgaagaagttgaagacatactgcaggagtttgtt
aataagtctctcttattctgtgatcggaatggaaaatcattttgttattatttacatgat
cttcaagtagatttccttatagaaaagaatcgcaaccagcttcaggatctacataagaag
ttaatcactcagttccagagacatcaccagccacatactctttcaccagatcaggaggac
tgcatgtattggtacaattttctggcttaccacatggctagtgctaacatgcacaaagaa
ctttgtgctttaatgttttccctggattggattaaagcaaaaactgaactcgtaggccct
gcccatctgattcatgagtttgtggaatataggcatatattggatgaaaaggattgtgca
gtctgtgaaaatttccaagagtttttatcattaaatggacaccttcttggacgacagcca
tttcctaatattgttcaactgggtctctgtgaaccagaaacttcagaagtttatcagcaa
gctaagctgcaggccaagcaggaggtcgataatggaatgctttacctggagtggataaac
aaaaaaaacaacaagaatctttcccgcttagttgtccgcccccatacagatgctgtttac
catgcttgcttttctgaggatggtcaaagaatagcttcttgtggagttgataaaacctta
caggtgttcaaagctgaaacaggagagaaacttctggaaatcaaggctcatgaggatgaa
gtgctttgttgtgcattctctgcagatgacagattcatagcaacctgctcagtggataaa
aaagtgaagatttggaattctatgactggggaactagtacatatctatgatgagcactca
gagcaagtcaattgctgccactttaccaacaacagtcatcaccttctcttagccactgcg
tcaagtgactgtttcctcaaactgtgggatttgacccaaaaagagtgtcggaataccatg
tttggccacacaaattcagtcaatcactgcagattttcaccagatgataagcttttggct
agttgttcagctgatggaacattaaagctttgggatgtgaaatcagcaaacgagagggaa
agcattaatgtgaagcaattcttcctaaattcagaggagcctcaagaggatatggaagtg
atagtgaaatgttgttcatggtctgctgatggtgctagcataatggtggcagcaaaaaat
aagatctttctttttgacattcatgccagtggcctgttggcagaaatccatacaggccat
catagcaccatccagtactgtgacttctccccacaaaatcgtttggcagtggtggctttg
tcccagtgctgtgtagagttgtggaacatggactcgtgtttaaaagtggctgactgcaga
ggacatttaagttgggttcattgtgtgatgttttctcctgatggatcatcatttttgaca
tcttctgatgaccagacaatcaggctctgggagacaaagaaagtatgtgagaactctgct
atagtgttaaagcaagacatagatgttgtgtttcaagaaaatgaagtgatggttcttgca
gttgacaatgtaagacatctgcagctcattaatggaaaaacaggtcagactgattatctg
acagaagctcaagttagttgctgttgcttaagtccacatcttgagtacattgcatttgga
ggcgaagatggagccattgagattttagaactcctaaacaacagaatcttccaatccaga
attgggcacaagaaaactgtacggcacatccagttcacagatgatgggaaaactcttatt
tcaagctctgatgattcttcaattcaggtgtggaattggcaatcagaggaatatgtcttt
ctacaagcccatcaggaaacagtgaaagactttaggcttttgaaaaattcaagactgctt
tcctggtcatttgatggaacagtgaaggtgtggagtattattactggaagaatagaaaaa
gattttgtctgtcaccaagatacagtactttcttgtgatatttctcctgatgctactaaa
ttttcatctacatctgctgacaagactgcaaagatttggagttttgaacttctttcccct
cttcatgagctgaggggccacaaaggctgtgtgcgctgctctgccttctctgtggacagt
accctgttggcgactggagatgacaatggagaaatcaggatatggaatgtctcaaatggt
gagctgcttcatttatgcgctccgatttcagtagaagaaggagctgccacccatggaggc
tgggtgactgacctttgcttttcaccagatagcaaaatgcttgtctctgctggaggatat
cttaagtggtggagtgttgacactggggaatcctcacagatcttctacacaaatggaacc
aatcttaagaaaatacacgtgtctcctgacttcaaaacatatgtgactgttgataatctt
ggtattttatatattttacagatgttagagtaa

DBGET integrated database retrieval system