KEGG   Felis catus (domestic cat): 768259Help
Entry
768259            CDS       T02385                                 

Gene name
HTRA2
Definition
(RefSeq) serine protease HTRA2, mitochondrial isoform X1
  KO
K08669  HtrA serine peptidase 2 [EC:3.4.21.108]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04210  Apoptosis
fca04215  Apoptosis - multiple species
fca05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    768259 (HTRA2)
   04215 Apoptosis - multiple species
    768259 (HTRA2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    768259 (HTRA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fca01002]
    768259 (HTRA2)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:fca03110]
    768259 (HTRA2)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.108  HtrA2 peptidase
     768259 (HTRA2)
Peptidases [BR:fca01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   768259 (HTRA2)
Chaperones and folding catalysts [BR:fca03110]
 Other chaperones and cochaperones
  DegP / HtrA
   768259 (HTRA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin_2 Trypsin PDZ_6 PDZ_2 PDZ Peptidase_S46 GRASP55_65 Tricorn_PDZ
Motif
Other DBs
NCBI-GeneID: 768259
NCBI-ProteinID: XP_003984202
Ensembl: ENSFCAG00000007157
UniProt: M3W782
Position
A3
AA seq 458 aa AA seqDB search
MAALRAGRGAGWNLWGWRALGGVPWGKGPLLTPDLRALLTSGTPDPRARVTYGTPSLWAR
LSGGVPEPRTCLTSGTSDSRARLTAGSPDLKTREVSETPGTRPRIWLAVALGAGGAVLLL
LWGGGRGPPAVLASVLGSPPTSPRSQYNFIADVVEKTAPAVVYIEILGRHPFSGREVPIS
NGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAMVTAVDPVADIATLRIQTKEPL
PTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAA
IDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSWFGISGSQRR
YIGVMMLTLTPSILAELQLREPSFPDVQHGVLIHKVILDSPAHRAGLRPGDVILAIGEQL
VQNAEDIYEAVRTQSQLAVRIRRGPETLTLYVTPEVTE
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggctgcactgagggcggggcggggtgcaggctggaacctctggggatggcgggctttg
gggggggttccctgggggaaggggcccctgttgacccctgacctccgggccttgctgacg
tcaggaactcctgaccctcgggcccgagtgacttatgggacccccagtctctgggcccgg
ttgtctgggggggtccctgaaccacggacatgtctgacgtcggggacttcggattcccga
gcacggctgactgcagggtccccggatctcaagacccgggaggtctcagagactcctgga
acccgtccgcgcatatggctggcggtagcgctgggcgctgggggggcagtgctgttgtta
ttgtggggcgggggtcggggtcctccagcggtcctcgcctcggtccttggctcaccgccc
acctctccccggagccagtacaacttcatcgcagacgtggtggagaagacagcacctgcc
gtggtttatatcgagatcttgggccggcaccctttctccggccgcgaagtccctatctcg
aatggctcaggattcgtggtggctgccgacgggctcatcgtaacgaacgcccatgtggtg
gctgatcggcgccgagtccgtgtgaggctgcttagcggcgacacgtatgaggccatggtc
acagctgtggatcctgtggcagacattgccacgctgaggattcagactaaggaacctctc
cccaccctacccctgggacgctcagccgatgtccggcaaggagagtttgttgttgccatg
ggaagtccctttgcactgcagaacacgatcacttctggcattgtcagctctgctcagcgt
ccagccagagacctgggcctcccccaaaccaatgtggaatacatccagactgatgcagct
attgattttggaaactctggaggtcctctggttaacctggatggggaggtgatcggagtg
aataccatgaaggtcacagctggaatctcctttgctatcccttctgatcgccttcgagag
tttctgcatcgtggggaaaagaagaattcctggtttggaatcagtgggtcccagcgccgc
tacattggggtgatgatgctgaccctgactcccagcatccttgctgaactacagcttcga
gaaccaagcttccctgatgttcagcatggtgtgctcatccataaagtcatcctggactcc
cctgcccaccgggctggtctacggccgggtgatgtgatcttggccattggggagcagctg
gtacaaaatgctgaagatatttatgaagctgttcgaacccaatcccagctggcagtgcgc
atccggcggggaccagaaacattgaccttatatgtgacccctgaagtcacagaatga

DBGET integrated database retrieval system