KEGG   Felis catus (domestic cat): 768260Help
Entry
768260            CDS       T02385                                 

Gene name
CASP9
Definition
(RefSeq) caspase-9 isoform X1
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01524  Platinum drug resistance
fca04115  p53 signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04210  Apoptosis
fca04215  Apoptosis - multiple species
fca04370  VEGF signaling pathway
fca04919  Thyroid hormone signaling pathway
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis (ALS)
fca05016  Huntington disease
fca05134  Legionellosis
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05210  Colorectal cancer
fca05212  Pancreatic cancer
fca05213  Endometrial cancer
fca05215  Prostate cancer
fca05222  Small cell lung cancer
fca05223  Non-small cell lung cancer
fca05416  Viral myocarditis
Module
fca_M00685  Apoptotic machinery
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    768260 (CASP9)
   04151 PI3K-Akt signaling pathway
    768260 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    768260 (CASP9)
   04215 Apoptosis - multiple species
    768260 (CASP9)
   04115 p53 signaling pathway
    768260 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    768260 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    768260 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    768260 (CASP9)
   05212 Pancreatic cancer
    768260 (CASP9)
   05215 Prostate cancer
    768260 (CASP9)
   05213 Endometrial cancer
    768260 (CASP9)
   05222 Small cell lung cancer
    768260 (CASP9)
   05223 Non-small cell lung cancer
    768260 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    768260 (CASP9)
   05012 Parkinson disease
    768260 (CASP9)
   05014 Amyotrophic lateral sclerosis (ALS)
    768260 (CASP9)
   05016 Huntington disease
    768260 (CASP9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    768260 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    768260 (CASP9)
   05152 Tuberculosis
    768260 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    768260 (CASP9)
   05162 Measles
    768260 (CASP9)
   05164 Influenza A
    768260 (CASP9)
   05161 Hepatitis B
    768260 (CASP9)
   05160 Hepatitis C
    768260 (CASP9)
   05168 Herpes simplex virus 1 infection
    768260 (CASP9)
   05163 Human cytomegalovirus infection
    768260 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    768260 (CASP9)
   05169 Epstein-Barr virus infection
    768260 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    768260 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    768260 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    768260 (CASP9)
   01002 Peptidases [BR:fca01002]
    768260 (CASP9)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     768260 (CASP9)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     768260 (CASP9)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C14: caspase family
   768260 (CASP9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 CARD CARD_2
Motif
Other DBs
NCBI-GeneID: 768260
NCBI-ProteinID: XP_011282894
Ensembl: ENSFCAG00000026776
Position
C1
AA seq 451 aa AA seqDB search
MDEADRQLLRRCRVRLVGELQVASLWDALLTRQLFTPAMIEDIQHAGSGSRSDQVRQLVI
DLETRGSQALPLFISCLEDTGQDALASLLRMGRQAEKQNPQAVRPLDLMPVVVGPMGLKP
EELRRRQYPLKPTPEKLTPVVLGPEELWPAKLRPEVLRPEVPRPVDIGSGPFSDICAQEI
SKRNADLAYVLNADPCGHCLIINNMNFCLESRLQTRTGSNIDCEKLQRRFSLLHFMVEVK
HDQTAKQMVQVLVELAQRDHGALDCCVVVILSHGCQASHRQFPGAVYGTDGCPVSIEKIV
NIFNGSGCPSLGGKPKLFFIQACGGERKDHGVEVASTSPEDRTPGSDPEPDAVPFQEGPG
TFDQPDAVSSLPTPSDIFVSYSTFPGFVSWRDTKSGSWYVETLDGVFEQWARSEDLQTLL
LRVANAVSQKGIYKQIPGCFNFLRKKLYFKM
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggacgaggctgaccggcagctcctgcggcggtgccgggtgcggctggtcggcgagctg
caggtggcctcgctctgggacgctctgctgacccgccagctcttcacgcccgcgatgatc
gaggacatccagcatgctggctcagggtctcggagcgatcaggtcaggcagcttgtcata
gatctagagacccgagggagtcaggcccttcctttgttcatctcctgcttagaggacaca
ggccaggatgcgctggcttcattgctgagaatgggtcggcaagcagaaaagcagaatcca
caggccgtcagacccctggacctcatgcctgtggtggttggaccaatgggcctcaaacca
gaggagctcagaaggaggcagtatcctttaaagccgactccggaaaaactcactccagtg
gtgttggggcccgaggagctgtggccagccaagctccggccagaggttctcagaccagag
gtgcctaggccagtggacattggttctggaccattcagtgatatctgtgctcaggaaatt
tcgaagcgaaatgctgatttggcgtatgtcctgaacgcggacccctgtggccactgcctc
atcatcaacaacatgaacttctgcctcgagtcgaggctccagacccgtaccggctccaat
atcgactgtgagaagttgcagcgacgtttctccttgctgcatttcatggtggaggtgaag
cacgaccagacggccaagcaaatggtccaggtgttggtggagctggctcagcgggaccac
ggtgctctggactgctgcgtggtggtcatcctctctcacggctgtcaggccagccaccgc
cagttcccaggggctgtttatggcacagatggctgtcctgtgtccatcgagaaaattgtg
aacatcttcaatggatccggctgccccagcttgggagggaagcccaagctcttctttatc
caggcctgtggtggggagcggaaagaccatggggttgaggtggcctccacgtcccctgaa
gacaggacccctggcagtgaccccgagccagacgctgtcccgttccaggaaggcccaggc
acctttgaccagccagacgccgtgtctagtttgcccacacccagtgacatctttgtgtcc
tactccaccttcccaggttttgtttcctggagggacaccaagagcggctcctggtatgtg
gagaccttggatggtgttttcgagcagtgggctcgctctgaggacctgcagaccctcctg
ctcagggtcgctaatgctgtttcgcagaaagggatttacaagcagattcctggttgtttc
aatttcctccggaaaaaactttactttaaaatgtaa

DBGET integrated database retrieval system