KEGG   Felis catus (domestic cat): 768262Help
Entry
768262            CDS       T02385                                 

Gene name
CASP7
Definition
(RefSeq) caspase-7 isoform X1
  KO
K04397  caspase 7 [EC:3.4.22.60]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04210  Apoptosis
fca04215  Apoptosis - multiple species
fca04668  TNF signaling pathway
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05133  Pertussis
fca05134  Legionellosis
fca05200  Pathways in cancer
Module
fca_M00685  Apoptotic machinery
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    768262 (CASP7)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    768262 (CASP7)
   04215 Apoptosis - multiple species
    768262 (CASP7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    768262 (CASP7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    768262 (CASP7)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    768262 (CASP7)
  09171 Infectious disease: bacterial
   05133 Pertussis
    768262 (CASP7)
   05134 Legionellosis
    768262 (CASP7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fca01002]
    768262 (CASP7)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.60  caspase-7
     768262 (CASP7)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C14: caspase family
   768262 (CASP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14
Motif
Other DBs
NCBI-GeneID: 768262
NCBI-ProteinID: XP_006938255
Ensembl: ENSFCAG00000011831
Position
D2
AA seq 301 aa AA seqDB search
MADDQGCGVEQAAGDSASRDAVDAKPDRSSFVPSLFSKKKKNGSGRSVTTTQDRVPAYQY
NMNFEKVGKCIIINNKNFDKKTGMGVRNGTDKDAEALFKCFRNLGFDVVVYNDCSCARMQ
DLLKQASEEDHRNSACFACILLSHGEENLIYGTDGVTAIKDLTAHFRGDRCKTLLEKPKL
FFIQACRGTELDDGVQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRNPGSGSW
FVQALCSILDEHGKSLEILHILTRVNNRVARHFESQSDDPYFHEKKQIPCVVSMLTKELY
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgatcagggctgtggcgtggagcaggcagctggggactcagcaagcagagat
gcagttgatgctaagccagaccggtcttcctttgtgccatcactcttcagtaagaagaag
aaaaatggctcgggaagatcagtcacgaccacccaggaccgagtgcctgcatatcagtat
aacatgaattttgagaaggtgggcaaatgcatcataataaacaacaagaacttcgacaaa
aagacaggcatgggcgtccgaaacggaacagacaaagatgccgaggctcttttcaagtgc
ttcagaaacctgggttttgacgtggtcgtctacaatgactgctcttgtgccagaatgcaa
gatctgctgaaacaagcctctgaagaggaccacagaaattcggcttgtttcgcctgcatc
ttactaagccacggagaagaaaatttaatttatggaacagacggcgtgacagcaataaag
gacttgacagcccattttaggggggacagatgcaaaactcttctagagaaacccaaactc
ttcttcattcaggcttgccgggggaccgagctcgatgacggggtccaggctgactcgggg
cctatcaatgacacagatgccaatccccgatacaagatccccgttgaagccgactttctc
ttcgcctattctacagtcccaggctattactcatggaggaacccgggcagcgggtcctgg
tttgtgcaggccctgtgctccatcctggacgagcatggcaagagcctggagatcctgcat
atcctcaccagggtgaacaacagggtggccaggcactttgagtcccagtccgatgacccc
tacttccacgagaagaagcagatcccatgtgtggtctctatgctcaccaaggaactctac
ttctga

DBGET integrated database retrieval system