KEGG   Felis catus (domestic cat): 768269Help
Entry
768269            CDS       T02385                                 

Gene name
BAD
Definition
(RefSeq) bcl2-associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca01524  Platinum drug resistance
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04140  Autophagy - animal
fca04151  PI3K-Akt signaling pathway
fca04210  Apoptosis
fca04370  VEGF signaling pathway
fca04510  Focal adhesion
fca04722  Neurotrophin signaling pathway
fca04910  Insulin signaling pathway
fca04919  Thyroid hormone signaling pathway
fca05010  Alzheimer disease
fca05014  Amyotrophic lateral sclerosis (ALS)
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05165  Human papillomavirus infection
fca05168  Herpes simplex virus 1 infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05210  Colorectal cancer
fca05211  Renal cell carcinoma
fca05212  Pancreatic cancer
fca05213  Endometrial cancer
fca05215  Prostate cancer
fca05218  Melanoma
fca05220  Chronic myeloid leukemia
fca05221  Acute myeloid leukemia
fca05223  Non-small cell lung cancer
fca05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    768269 (BAD)
   04012 ErbB signaling pathway
    768269 (BAD)
   04370 VEGF signaling pathway
    768269 (BAD)
   04024 cAMP signaling pathway
    768269 (BAD)
   04022 cGMP-PKG signaling pathway
    768269 (BAD)
   04151 PI3K-Akt signaling pathway
    768269 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    768269 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    768269 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    768269 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    768269 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    768269 (BAD)
   04919 Thyroid hormone signaling pathway
    768269 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    768269 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    768269 (BAD)
   05203 Viral carcinogenesis
    768269 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    768269 (BAD)
   05212 Pancreatic cancer
    768269 (BAD)
   05225 Hepatocellular carcinoma
    768269 (BAD)
   05221 Acute myeloid leukemia
    768269 (BAD)
   05220 Chronic myeloid leukemia
    768269 (BAD)
   05218 Melanoma
    768269 (BAD)
   05211 Renal cell carcinoma
    768269 (BAD)
   05215 Prostate cancer
    768269 (BAD)
   05213 Endometrial cancer
    768269 (BAD)
   05223 Non-small cell lung cancer
    768269 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    768269 (BAD)
   05014 Amyotrophic lateral sclerosis (ALS)
    768269 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    768269 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    768269 (BAD)
   05162 Measles
    768269 (BAD)
   05161 Hepatitis B
    768269 (BAD)
   05160 Hepatitis C
    768269 (BAD)
   05168 Herpes simplex virus 1 infection
    768269 (BAD)
   05165 Human papillomavirus infection
    768269 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    768269 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    768269 (BAD)
   01524 Platinum drug resistance
    768269 (BAD)
   01522 Endocrine resistance
    768269 (BAD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2_BAD Bclx_interact
Motif
Other DBs
NCBI-GeneID: 768269
NCBI-ProteinID: XP_003993607
Ensembl: ENSFCAG00000000508
Position
D1
AA seq 168 aa AA seqDB search
MFQIPEFEPSEQEDSSPTDRGLGPSPTGDRPRGPGKHQRTTPGLLGEAGHQQGQPASSNH
HGGAGAVETRSRHSSYPAGTEEDEGTEEEEPSPFRGRSRSAPPNLWAALRYGRELRRMSD
EFQGSFKGLPRPKSAGTATQMRQSPSWTRFIQSWWDRNLGRGGSAPSQ
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagcccagtgagcaggaagactccagccctacggatagg
ggcctgggccccagccccacaggggaccggccccgcggccctggcaagcaccagcggacg
accccaggcctcctcggggaagctggtcaccagcaggggcagcccgccagcagcaaccac
catggaggcgctggggctgtggagacccggagtcgccacagctcgtaccccgccgggacc
gaggaggatgaagggacggaggaggaagagcccagccctttccggggtcgctcgcgctca
gcgccccccaacctctgggctgccctgcgctacggccgcgagctccggaggatgagcgac
gagttccagggctccttcaagggacttccacgcccgaagagcgcgggcacagcgacgcag
atgcggcaaagccccagctggacgcgcttcatccagtcctggtgggatcggaacttgggg
agaggaggctccgccccctcccagtga

DBGET integrated database retrieval system