KEGG   Felis catus (domestic cat): 768274Help
Entry
768274            CDS       T02385                                 

Gene name
IL1B
Definition
(RefSeq) interleukin-1 beta precursor
  KO
K04519  interleukin 1 beta
Organism
fca  Felis catus (domestic cat)
Pathway
fca01523  Antifolate resistance
fca04010  MAPK signaling pathway
fca04060  Cytokine-cytokine receptor interaction
fca04064  NF-kappa B signaling pathway
fca04217  Necroptosis
fca04380  Osteoclast differentiation
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca04625  C-type lectin receptor signaling pathway
fca04640  Hematopoietic cell lineage
fca04657  IL-17 signaling pathway
fca04659  Th17 cell differentiation
fca04668  TNF signaling pathway
fca04750  Inflammatory mediator regulation of TRP channels
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04940  Type I diabetes mellitus
fca05010  Alzheimer disease
fca05020  Prion diseases
fca05132  Salmonella infection
fca05133  Pertussis
fca05134  Legionellosis
fca05140  Leishmaniasis
fca05142  Chagas disease (American trypanosomiasis)
fca05143  African trypanosomiasis
fca05144  Malaria
fca05146  Amoebiasis
fca05152  Tuberculosis
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05168  Herpes simplex virus 1 infection
fca05321  Inflammatory bowel disease (IBD)
fca05323  Rheumatoid arthritis
fca05332  Graft-versus-host disease
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    768274 (IL1B)
   04064 NF-kappa B signaling pathway
    768274 (IL1B)
   04668 TNF signaling pathway
    768274 (IL1B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    768274 (IL1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    768274 (IL1B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    768274 (IL1B)
   04620 Toll-like receptor signaling pathway
    768274 (IL1B)
   04621 NOD-like receptor signaling pathway
    768274 (IL1B)
   04623 Cytosolic DNA-sensing pathway
    768274 (IL1B)
   04625 C-type lectin receptor signaling pathway
    768274 (IL1B)
   04659 Th17 cell differentiation
    768274 (IL1B)
   04657 IL-17 signaling pathway
    768274 (IL1B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    768274 (IL1B)
  09158 Development
   04380 Osteoclast differentiation
    768274 (IL1B)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    768274 (IL1B)
   05321 Inflammatory bowel disease (IBD)
    768274 (IL1B)
   05332 Graft-versus-host disease
    768274 (IL1B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    768274 (IL1B)
   05020 Prion diseases
    768274 (IL1B)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    768274 (IL1B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    768274 (IL1B)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    768274 (IL1B)
   04933 AGE-RAGE signaling pathway in diabetic complications
    768274 (IL1B)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    768274 (IL1B)
   05133 Pertussis
    768274 (IL1B)
   05134 Legionellosis
    768274 (IL1B)
   05152 Tuberculosis
    768274 (IL1B)
  09172 Infectious disease: viral
   05162 Measles
    768274 (IL1B)
   05164 Influenza A
    768274 (IL1B)
   05168 Herpes simplex virus 1 infection
    768274 (IL1B)
   05163 Human cytomegalovirus infection
    768274 (IL1B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    768274 (IL1B)
   05144 Malaria
    768274 (IL1B)
   05140 Leishmaniasis
    768274 (IL1B)
   05142 Chagas disease (American trypanosomiasis)
    768274 (IL1B)
   05143 African trypanosomiasis
    768274 (IL1B)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    768274 (IL1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    768274 (IL1B)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    768274 (IL1B)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Interleukins
   768274 (IL1B)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate/Haparin
  Cytokines
   768274 (IL1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL1 IL1_propep
Motif
Other DBs
NCBI-GeneID: 768274
NCBI-ProteinID: NP_001070882
Ensembl: ENSFCAG00000005899
UniProt: P41687
Position
A3
AA seq 267 aa AA seqDB search
MAPVPELTSEMMAYYSDENDLFFEADGPEKMKGSLQNLSHSFLGDEGIQLQISHQPDNKS
LRHAVSVIVAMEKLKKISFACSQPLQDEDLKSLFCCIFEEEPIICDTWDDGFVCDAAIQS
QDYTFRDISQKSLVLSGSYELRALHLNGQNMNQQVVFRMSFVHGEENSKKIPVVLCIKKN
NLYLSCVMKDGKPTLQLEMLDPKVYPKKKMEKRFVFNKTEIKGNVEFESSQFPNWYISTS
QAEEMPVFLGNTKGGQDITDFIMESAS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggcaccagtacctgaactcaccagtgaaatgatggcttactacagtgatgagaatgac
ctgttctttgaggctgatggccccgaaaagatgaagggcagcctccaaaacctgagccac
agttttctgggagatgagggcatccagttgcaaatctcccaccagcccgacaacaagagt
cttaggcatgccgtgtcggtcattgtggctatggagaaactgaagaagatatcttttgcc
tgctcacaacccctccaggatgaggacctgaagagcctcttttgctgcatctttgaagaa
gaacccatcatctgtgacacgtgggatgacggttttgtgtgtgatgcagccatacagtca
caggactacacgttccgagacataagccaaaagagcctggtgctgtctggctcatacgag
cttcgggctctccacctcaatggacagaatatgaaccaacaagtggtgttccgcatgagc
tttgtgcacggggaggaaaatagtaagaagataccagtagtgttgtgcatcaagaaaaat
aacctgtacctgtcctgtgtgatgaaagacgggaaacccaccctacagctggagatgtta
gaccccaaagtttacccaaagaagaagatggaaaagcgatttgtcttcaacaagacagaa
atcaagggcaatgtggaatttgagtcttcccagttccccaactggtacatcagcacctct
caagcagaagaaatgcctgtcttcctaggaaataccaaaggtggccaggatataactgac
ttcatcatggaaagcgcttcctaa

DBGET integrated database retrieval system