KEGG   Folsomia candida: 110841790Help
Entry
110841790         CDS       T05043                                 

Definition
(RefSeq) ATP-dependent RNA helicase DHX8-like
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
fcd  Folsomia candida
Pathway
fcd03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110841790
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:fcd03041]
    110841790
Enzymes [BR:fcd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     110841790
Spliceosome [BR:fcd03041]
 Complex C
  Other components
   Step II factors
    110841790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C
Motif
Other DBs
NCBI-GeneID: 110841790
NCBI-ProteinID: XP_021943178
Position
Unknown
AA seq 381 aa AA seqDB search
MEIVNSYLFKQIVLATNIAETTLTIDGIVYVVDSGLVKLKEHNPKSGIDTLTKIRIMKAQ
AIQRRGRAGRTQPGKCYRLYSQYEFSRMKSEAIPEIQRTNVESVVLQLASLGVRDILQFD
FMSPPKLDAVMEALEHLQQLGALDDHMALTEMGRKMSEFPLDPPLAKVLITSASLHCTEE
ILTIVALLSTQHQNLFVNSKKVRVLANEKKAQFNHPDGDHLTLLKVYNAWRLNYYEREWC
RKNFVQYRSLVEAGEIRAQLSDMVESHGLPLLSCGRDTVNIRKAFCSGFFRRLAKSVVRV
KGGYSTFTNETALIPQVVFVHPNSSLFPLSLTPEWILYHEVVKTKKAYMRAIVTVEPAWV
KQFAPKFVSRMARKYPELGNI
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcgtcaattcatatttgttcaaacagatcgtgctagccacaaacattgccgag
acaacgttaacaatagacggcattgtttacgtggtcgactccggattagttaagcttaag
gagcacaatccgaaatccgggattgatactttaacaaaaatccgaattatgaaggcacaa
gcaatccaacgaaggggtcgcgccggacgcacccaacccggcaagtgttaccgactctac
agccaatacgaattttcccgaatgaaaagcgaagccatcccagaaattcagcggaccaac
gtggagtccgtcgtgctacaattagcctccttaggagtcagagacatccttcaattcgat
tttatgtcccctccaaaattggacgctgtcatggaagccttagaacacttacagcagctc
ggcgccctcgacgaccacatggcgttgacagaaatgggtcgaaaaatgtctgagtttccg
ctggatcctcccctcgcgaaggttctcatcacatctgcatcactccactgcaccgaggaa
atcttgacaatcgtcgccctgttgtcgacccagcatcaaaatttgttcgtcaattcgaag
aaggtcagagtcctggcgaatgagaagaaggcgcagttcaatcacccggatggcgatcat
cttacgctgctcaaagtgtataatgcgtggcgtttaaattactatgagagggagtggtgt
cgtaagaactttgtgcagtatcgaagtctcgtcgaagcgggggaaataagggcacagttg
tcggatatggttgagagccacggtctccccctcctctcttgtggtcgggacacggtcaat
attcggaaagcattctgttccggatttttcagaagactggcgaaatctgtggttcgcgtt
aaaggaggatattccacgtttaccaatgagaccgcgttgataccgcaggtcgtctttgtg
cacccgaacagttccttattccccctcagtctgacgccagaatggattttgtaccatgaa
gtggtcaaaactaagaaggcctatatgagagcgattgtcaccgtggaacctgcttgggtc
aaacagtttgcgccaaagtttgtgtccaggatggccagaaagtatccggaacttggcaat
atttaa

DBGET integrated database retrieval system