KEGG   Folsomia candida: 110843028Help
Entry
110843028         CDS       T05043                                 

Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 4-like
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
fcd  Folsomia candida
Pathway
fcd00061  Fatty acid biosynthesis
fcd00071  Fatty acid degradation
fcd01100  Metabolic pathways
fcd01212  Fatty acid metabolism
fcd04146  Peroxisome
Module
fcd_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    110843028
   00071 Fatty acid degradation
    110843028
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    110843028
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:fcd01004]
    110843028
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fcd04147]
    110843028
Enzymes [BR:fcd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     110843028
Lipid biosynthesis proteins [BR:fcd01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   110843028
Exosome [BR:fcd04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   110843028
  Exosomal proteins of breast cancer cells
   110843028
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C Cas_APE2256
Motif
Other DBs
NCBI-GeneID: 110843028
NCBI-ProteinID: XP_021944623
Position
Unknown
AA seq 785 aa AA seqDB search
MAKRVENGGSGGVLKSNGSRNNNNSAVSAAGGGRSGSNSGSLVDLVRHYLFLFDGDEAEL
GTPVRLLLPDKKLGFGGTLVVALLKAISLAYDVVTWFGYYWFQKKSPREKVLLHTEIKAE
VVSRGEGSCTWRSDREVRDIHVELEKGKIDTMHKVYTHAIRKNGLKRCLGTRELFKEEDE
IQENGKVFKKYEMGEYHWKSYAEVDRLSACFAAGLTTLNLQRKEKICIFAETRAEWLIAA
VGAFKHTFTIVTLYATLGEDAVVHGLNETESTVVLTSDELMPKFKSILKQTPHVKHLIYM
EHPLKKLDTSGYLDSVSIHSFCDVIERGSKLSIRLEAPEPDDVAIIMYTSGSTGVPKGVL
QSHKNVATAMLGLTDGLGPVYSDDIYVAYLPLAHVLELTCESICFLQGIPIGYSSPLTLT
NNSSKIKAGSKGDAVVLEPTIMVAVPFALDRIYKMVQEQVNQGGFIKQALFYFAYDYKLW
WYYKGYNTPLVDAIVMKKPKMAVGGKVRIMISGGAPLATDTHEFIRNCLCLPVVQGYGLT
ETCATATCSTPGDMSVGRVGPPLRCNDLRLVDWDEGNYTVNDVPLPRGELVIGGDNVAMG
YFKLPEATAQDFFVADGRRWFRTGDIAVADPDGCFRIIDRKKDLVKLQMGEYLSMGKIES
ILKTCKYIENVCIYGDAFKNVCVALVVPAQKHLELLSSSIGKPNLSLEEMCSDPQVEAAF
LKEIQSFSTAAKLHRFEIPAALKLCSELWTPDNNLVTAAFKLRRRNVQEWYQGDLDRMYA
KLSSS
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaagagtcgagaatggtgggagtggcggagttttaaaaagtaatgggagtaga
aataataataattctgcggtttctgctgctggtggtggacgaagtggcagtaatagtggt
agtttagttgatttggtgagacattatctttttctctttgatggggatgaagccgagttg
ggaactccggtaaggttactcttgcccgataagaagttaggatttggggggactttggtc
gtagcattgttgaaagccatcagtttggcatacgatgtcgtcacctggttcggatactac
tggttccaaaagaaaagtccgagggaaaaggttctgctacacacggagatcaaggccgaa
gtcgtatctcgtggcgaagggagttgtacatggcgttcggatcgagaagtgagagatatt
catgtagagctggaaaagggcaagattgatacgatgcacaaagtatatacacatgccata
cgaaaaaacggactgaaacgatgtcttggtacaagggaactgtttaaagaagaggatgaa
atacaagaaaatggaaaagtctttaaaaagtatgaaatgggcgaatatcactggaaaagt
tatgctgaggtggatcgtctctctgcatgctttgctgccggactcacgacactaaacctt
caacgaaaagaaaagatttgcatctttgccgaaacgagagccgaatggttgattgctgcc
gtgggagcgtttaagcatacttttacaatcgtcaccttgtacgccactcttggcgaagat
gccgtggtacacgggctcaacgagacagagtccactgtggttcttacgtcggatgaacta
atgcccaagttcaagtcaattttaaaacagactcctcacgtgaaacacctcatttacatg
gagcatccacttaaaaaattggacacttcaggatatttggatagtgtgagcatacactca
ttctgcgatgtgattgagcgtgggagtaaactgagtattcggcttgaagcacctgaaccg
gatgacgtggctataattatgtatacgagtggctcgaccggcgtaccgaagggggtgttg
caatcgcataagaatgtagcgactgctatgctcggactaactgatggacttggccccgtg
tattcggatgatatatacgtggcatatcttcctcttgcacacgttctagaattgacctgt
gaaagtatatgctttctgcaaggaattcctattggatactcgtccccattgacgcttacc
aataactcgtcaaagatcaaggctggctcaaagggagatgctgttgtgctcgaaccaact
attatggtggccgttcctttcgctttggacagaatatataaaatggtccaagaacaagta
aatcaaggtggatttataaagcaagccctcttctactttgcctacgactacaaattgtgg
tggtattataaaggatacaatactccactcgtggatgcaattgtcatgaaaaaaccgaaa
atggcagttggcggaaaagttaggattatgatctcgggaggagctccacttgccacagac
actcacgagttcattcgaaactgtttatgtcttcccgtagttcaaggatatggtctcaca
gaaacgtgtgcaacggcaacttgttctacacctggtgacatgagcgtgggtcgggttggt
cctcctctacgttgtaatgaccttcgcttagtcgattgggacgaaggaaattacactgtt
aatgatgtaccccttcctcgaggcgaacttgttatcggaggagacaatgtggcaatggga
tattttaaactaccagaagctacagctcaagactttttcgttgccgatggccgaagatgg
ttccgaactggagacattgctgtagctgatcctgatggctgttttagaattattgaccgc
aagaaagacttggtcaaacttcaaatgggggagtacctaagcatgggaaaaatagaatct
atccttaaaacttgcaaatacattgaaaacgtttgcatttatggtgatgcatttaagaac
gtctgcgtggccttggtcgttcctgcccagaaacacttggagttgctctcaagcagtatc
ggaaaaccaaatctgagcctggaagaaatgtgttcagatcctcaagtggaagctgctttc
cttaaagaaattcagagcttttccacagcagccaaactccatcgattcgaaattccagcc
gctctcaagctttgctctgaactctggaccccagacaacaacttggtaacggccgccttc
aaactgagacgacgcaacgtacaggaatggtatcagggcgatcttgatagaatgtatgca
aagttaagcagtagttga

DBGET integrated database retrieval system