KEGG   Folsomia candida: 110843640Help
Entry
110843640         CDS       T05043                                 

Definition
(RefSeq) cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1-like isoform X1
  KO
K14589  cap1 methyltransferase [EC:2.1.1.57]
Organism
fcd  Folsomia candida
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:fcd03019]
    110843640
Enzymes [BR:fcd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.57  methyltransferase cap1
     110843640
Messenger RNA biogenesis [BR:fcd03019]
 Eukaryotic Type
  mRNA processing factors
   5' end processing
    Capping factors
     110843640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FtsJ Peptidase_C70
Motif
Other DBs
NCBI-GeneID: 110843640
NCBI-ProteinID: XP_021945323
Position
Unknown
AA seq 916 aa AA seqDB search
MSRRSMEASSDSDSDEDGTNFKRRKISSSESRNGSRDVIKAKSVLQEPLPNFTASCHLKQ
LPSPNWTAKRTYFDRDNPEDNPCPVVVPSRPERGRNGTNTDYNANGNGVIPHPHEHLSAR
EISNFMGFGKGKGLANYLAEVDTLTGPKFSIEEFDDKVNVLGICLADMELQSVDDVSVKE
SIKWIISDDKPTLTFDMLVKGRKVGTQVTSIEIDPDNAFIDPHLYDELIECKKLFQNLSK
NDYQIVRSKGNLFEKLNKGPFLCRAAMKIANLDVVLNHELTQPVTRAGHRVLSMRDLFYF
ADVCGGPGGFTEYILWKKKWEAKGFGLTLKGEVDFDITNFLVETETFQTFYGEANDGNIY
NPVNVSSFIQHVIANTGKKGVHLMMADGGFSVTQRENMQEVLCHQIILSQIYVALAIVRV
GGHAVCKLFDVVTPFTAALIYLMYYCFESVTIHKPLASRPANSERYLICKWKKSEKVTSH
ITSYLGDCHQKMWMYMNGGNKEAILELVPVTLLASVLDPFYIYLRDCNNRIARSQIVTLK
RMVAFVKDRTLNNNEMQEEARIKAIKHWGIPKELPAPAMFKTPDNGCKAVMQELPLTMLR
RPEKDLAPENIELLFKSAYDWRFVPTTGFKKVSNRGFYLSLGQGSLYRYHESQWVSVPQF
AQKLLMPSNTLVYGEFGNEIYGNSGAEQTVIPVFHIIDALMLGGMDLRNVHCTQRQEMSV
KFAEAHTMPGTLQIRAKALIRMEHLAMFIQKLQYRLVKGAGNGARVVCPLDMTNPDSPFI
IPSGLLFLKITKDPWQMALNFQSHKKFFFNTVSGVSNDHIPGDAISGFFHTMGNRVLWTW
DSETNVTVTKLDADDPRINYFSQTRVHTCNLVSFINYMIRQRPSVTPPKTTLYIGAQKST
KQDGAETPTSSGLKNM
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgcaggagcatggaagcatcaagtgattcggatagtgatgaagatggtactaat
tttaagaggaggaaaatatcaagttccgaaagcaggaatggtagtagagatgttataaag
gccaagtcagtgcttcaagagccattgcccaactttacggcatcatgtcatttgaaacag
cttccatcaccaaactggaccgctaagcgtacatattttgatcgagataaccctgaggac
aacccatgtccggtagtagtaccatcgcgacctgaacgaggaagaaatggtactaatact
gactacaatgcaaatgggaatggtgtaatacctcatccgcatgagcacttgtctgccagg
gaaatttcaaattttatgggatttgggaaagggaagggtctagccaattatttagccgaa
gttgatacgttgactggtcccaaattttcgatcgaagaatttgacgataaagtaaacgtg
cttggaatctgtctagctgatatggagctccaaagcgtggacgatgtgtcggtaaaggaa
agcatcaaatggattatttctgatgacaaacccacgttgacttttgacatgttggtaaaa
gggagaaaagttggaacacaagtaacctctattgaaattgaccctgacaacgccttcatt
gatcctcacttgtatgatgaattaatagaatgcaagaaactatttcaaaacttgagcaaa
aatgattatcagattgtgaggagcaaaggtaatttattcgaaaaattgaacaaaggaccc
ttcttgtgtcgagcagcaatgaagattgcgaaccttgatgttgttctcaatcacgaactc
acccagccagtgactagagctggacatcgggttttaagcatgcgtgacttattttacttt
gctgatgtatgtggtggtcctggaggatttacagaatacattttatggaaaaagaaatgg
gaggcaaaaggatttgggttgactttgaaaggagaagtagactttgatattacaaatttc
ctcgttgaaaccgagacatttcaaacattttatggggaagccaatgacggcaatatttac
aatcctgttaacgtctcgagttttatccagcatgtaatcgctaacaccgggaaaaaaggg
gttcacctcatgatggcagacggaggcttctcggtgacacagagagagaatatgcaagaa
gtactgtgtcatcaaatcattttatcacaaatttatgttgcactcgcgattgtccgagtc
ggcggacacgcagtatgcaaactttttgacgtagtcacacctttcactgcggctcttata
tacttaatgtattactgtttcgagtctgtgaccattcataaaccactggcaagtcgccct
gcaaattcggaacggtatttgatttgtaaatggaaaaaatcggagaaggtaacatcacac
atcactagctatcttggggactgtcaccagaaaatgtggatgtacatgaatggtggcaat
aaggaggctattttggaacttgttcctgtcacactccttgcaagtgttttagatccattt
tatatttatcttcgggattgtaacaacaggattgcgcgtagtcaaattgtgacccttaaa
cgaatggttgcttttgtgaaagacaggaccctgaacaataatgaaatgcaggaggaagcg
aggataaaggcaataaaacattggggtattcctaaagaacttcctgcaccagcaatgttt
aagacgccggacaacggttgcaaagcggttatgcaggaactaccattgaccatgctaaga
cgtccagaaaaagatctagcgcctgaaaatatcgaattgttattcaagtcggcatatgat
tggcgttttgtgccgacgacgggatttaagaaagtatcgaatcgaggattttacttgtca
cttggacaaggttcactatatagataccatgagtcgcaatgggtttctgttccacaattc
gcccagaagcttctgatgccgtccaacactcttgtgtatggggagtttggaaatgaaata
tatggaaactctggcgcagagcagaccgtaatcccagtctttcacattattgatgcatta
atgttagggggtatggatttacggaatgtgcattgtacacaaaggcaagaaatgagcgtg
aaatttgcagaagctcacacaatgcctggaacgttacaaattcgggcaaaagctttaatt
cgcatggaacatttggcaatgttcattcaaaaactgcaatatcggctcgtgaaaggtgcc
ggcaatggagccagagttgtgtgccccctcgacatgacgaatcctgactctccgtttata
attcccagtggactattgttcttaaaaattactaaagatccgtggcaaatggctttgaat
tttcaaagccataaaaagttttttttcaacacagtatctggagtttcaaatgatcacatc
cctggagatgccatatctgggttctttcacacaatggggaaccgagtgttgtggacctgg
gatagcgaaacaaatgtcactgtaacaaaattggatgcagatgatcctcgaatcaattat
ttttcccaaactcgtgtacacacatgtaatttggtgtctttcatcaattacatgattcga
caacgcccatcagtaacaccaccaaaaactacgctttacattggagctcagaaatcgaca
aaacaggacggagctgagacaccaacttcctcaggcttgaagaatatgtga

DBGET integrated database retrieval system