KEGG   Folsomia candida: 110844114Help
Entry
110844114         CDS       T05043                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like isoform X1
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
fcd  Folsomia candida
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fcd01002]
    110844114
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fcd04147]
    110844114
Enzymes [BR:fcd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     110844114
Peptidases [BR:fcd01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   110844114
Exosome [BR:fcd04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   110844114
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 DUF900 Lipase_3 DUF676 Abhydrolase_3 DUF126 PGAP1 DUF818
Motif
Other DBs
NCBI-GeneID: 110844114
NCBI-ProteinID: XP_021945929
Position
Unknown
AA seq 374 aa AA seqDB search
MGLGLRALFTAITAGAVLILTVWYYEMQIHFGFKIAVGATILLYLFIPFLFHFSISIQQH
LVFLPFVRWPHNVNFSAPETEELFGTRNLYLTPEEGISIGVWHLLPNSLIADSKGRNDEY
WENAMRNSGRPIILYLHGNSGSRAGPHRKELYQILQELDSHVLCLDYRGYADSTQVAPTE
TGVVSDARALYKYIRRIVGNTGNTKIFVWGHSLGTGVASHMVADLCVEGDSPAALILESP
FTNIGEEVKNHMLSAIYRYLPGFDYIFVRPLEKNDIAFQSDRHIAKIDIPIAIFHAIDDP
VVPFALGVKLFRIAGRSRGTLAKPVYFKRFGEGFAHKFICRSPDLPNLVKQFQNCTTSDT
WPCVGFDNFNIEIE
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgggattgggtttacgagctcttttcactgcaataaccgccggagctgttttaatttta
acagtttggtactatgaaatgcaaatacattttggatttaaaattgctgtcggagctaca
attctactctatctgtttataccattcctattccacttcagtatttcaattcagcaacat
ttagtctttctcccgtttgtacgttggccgcataatgtaaacttttctgctcctgaaacg
gaagaactctttggaaccaggaatctttatttgacgccagaagaaggcatttccattggc
gtctggcatctgcttccaaacagtctaattgcagattcgaaaggaaggaatgacgagtat
tgggaaaatgcaatgcgaaacagtggaaggcccataattctttatttgcatggaaattct
ggttccagggcagggccgcatagaaaagagctttatcaaatcttgcaagaattggacagt
catgtcctttgtttggattacagaggatatgcggattccacacaagttgcgccaaccgaa
actggcgtggtttcggatgccagggccctatataaatatattcgtagaattgtgggaaac
actggaaacaccaagatattcgtctggggtcattccttgggcactggggtcgcatctcat
atggtggcagatttatgcgttgaaggggacagtcctgctgcattaattttggagtcacca
tttactaatattggagaagaagtcaaaaaccatatgctttcagctatttaccggtatctc
cctggattcgattatatatttgtgagaccactggaaaaaaatgacattgcattccaaagt
gaccgtcatattgccaaaattgacattcctattgctatatttcatgcgattgatgatcct
gttgtcccatttgccctgggagtcaagctatttcggatagctggacgctcaagagggact
ttagcaaagccagtctactttaagagatttggagaaggatttgctcataaatttatttgc
agatctccggatcttcccaacttagttaaacagtttcaaaactgtaccacgtccgatacg
tggccatgtgttggatttgataactttaacattgaaattgagtaa

DBGET integrated database retrieval system