KEGG   Folsomia candida: 110846523Help
Entry
110846523         CDS       T05043                                 

Definition
(RefSeq) inositol hexakisphosphate kinase 1-like
  KO
K07756  inositol-hexakisphosphate 5-kinase [EC:2.7.4.21]
Organism
fcd  Folsomia candida
Pathway
fcd04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    110846523
Enzymes [BR:fcd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.21  inositol-hexakisphosphate kinase
     110846523
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IPK
Motif
Other DBs
NCBI-GeneID: 110846523
NCBI-ProteinID: XP_021948999
Position
Unknown
AA seq 512 aa AA seqDB search
MEEYLNEFQECEPVQLEPFIHQVGGHSSILCLDERTVCKPLIKQELQFYESLPVSMKKFT
PEYRGVVQVRFEEDKDGYLTVAAYPPKSFRYQPSQSKQRNNSRRRIRVKNSGSIEIEIES
ELNDLFVEEDPQQATTSKGVKSLNPWVLKCHQRQLSKLKRSATVPQQQKEPVCQKFLLLE
NITWRFEYPCILDLKMGTRQYGDDATPAKIESQSAKAANSTSVQLGVRICGMQVYQQSTG
KFLCRNKYYGRKLSVDGFKEAMLQFLHNGKRLRTDAVLPLIEKLKDLKAVLGTLETFRFY
TSSLLLAYEGLDPDYNGDDDSSMASVDSEMTDTSSFDSDSVSNPNNSTITTNPGPGEIRV
IHNFSEIKAPSSFLGMIPSSKSADEISLSLKRTSSLDKEESTPKNPKIGDSSCSSFSLET
VTEPACDGIGLGISQSQSNSTSISNVATRGSSAANSTTSLSLESVDVRMIDFAHATHSGL
DCGKEHQGADTGYMFGLSNLIKVFQEILDETC
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggaagaatacttgaatgaatttcaagaatgcgaaccagttcagctggagccatttatc
caccaagttgggggtcactcttcaatattatgtttggacgaacgaactgtgtgcaaaccg
cttataaaacaagaacttcagttttacgagtcactgccagtgtctatgaaaaagttcact
cctgaatatcgtggtgttgttcaggttcggtttgaagaagacaaagatggctacttaacc
gtagctgcttaccccccaaagtcgttcagatatcagccaagtcagtcaaagcagaggaac
aatagccgacgacggatccgagtgaagaattcaggaagcattgagattgaaattgagagc
gagctaaacgacctgtttgttgaagaggacccacagcaagccacaaccagcaaaggtgtc
aagtcactgaatccatgggtcttaaaatgtcaccagagacagctatcgaaattgaagaga
tctgctaccgtaccacaacaacagaaggaacccgtttgtcaaaaatttttgctgctggaa
aatatcacttggaggttcgaatacccctgtattctggacttgaaaatgggcacccgacaa
tatggagatgacgcgacacctgcaaagatcgaaagccagagtgccaaggcagccaactcc
acttcggtccagctaggagtccgaatttgtggaatgcaggtttatcaacaatcgacggga
aaatttctatgccggaacaagtactatggaagaaaattaagcgtggatggtttcaaggaa
gccatgttacaatttcttcataatgggaagcgtttgcggactgatgcagtacttccactt
attgaaaaactcaaggacttgaaagcagtcctaggcacacttgaaacttttaggttctat
acaagctctctgctgttagcctacgaagggctggaccctgattacaatggggacgacgac
tcatccatggcttccgtggatagtgagatgacggacacctcttcttttgatagcgattca
gtctcaaatcccaacaacagcaccatcaccacgaaccctggccctggagaaattcgagtt
atccacaatttctccgagatcaaagcaccttcctcttttctcggaatgattccatcgtcc
aaatccgcagatgaaatatctctctctttgaagaggacaagttctctcgacaaggaggaa
agtacaccaaagaatccaaagattggtgactcctcgtgctccagcttctctctagaaact
gtaaccgaaccagcatgtgatgggatcgggttgggaataagtcagagtcaaagcaattct
accagcatcagtaacgtggcgacgagaggaagttctgctgctaattcgacaacgtcattg
tctctggagtccgttgacgttagaatgattgatttcgctcatgcaacccatagtggactg
gactgtggcaaagagcatcaaggcgcagacacggggtacatgtttgggttgagtaatctg
atcaaagtatttcaggaaattttggacgaaacatgctaa

DBGET integrated database retrieval system