KEGG   Folsomia candida: 110847120Help
Entry
110847120         CDS       T05043                                 

Definition
(RefSeq) vacuolar protein sorting-associated protein 41 homolog
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
fcd  Folsomia candida
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fcd04131]
    110847120
Membrane trafficking [BR:fcd04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    110847120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin WD40 zf-RING_5
Motif
Other DBs
NCBI-GeneID: 110847120
NCBI-ProteinID: XP_021949670
Position
Unknown
AA seq 913 aa AA seqDB search
MVGDERDKGMSSMEDYDDFESGSLGDSASLDGVDDDEDEEDDEEEPKLNFIRIRNDLLGI
LEKDAVSCVAVHSKFLCIGSHRGELYIMDHLGNNVTPSPRGSFPAHKIMINCISIDAEGE
HIATCSDDGKVIVFNLCDGHCETTLSLDKKLRCVAIDPQYSKSSFSRRFLVGSDSAMLYQ
RNIFNLLKPFPILEGGIVSTIKWGSRFVAWSWKDEVRIYDIEEEIMISRVRFEWESNNLV
NNSLIEPSSLHMSSNGSKENLIKTLHEKYRCNIFWKDKYTVFIGWADIIKICQVVEIKNK
NIQPGAPSHYVKISCMFTTDFWTCGISSFSNYTTVLSLTKEFMAIGNGDTNNEYAKNNNL
PNVQILETDTTSYNVLQADALRTRGYTEYKPLDYHLESLIDEILFFIVSPKDIILAKARD
QDDHIQWLMERKKFEEALEVAIQDPKSLQRHSVMNVGLAYLDHLVENEMFADAGKLCFKL
FGKESPEKWEEQVLRFVPHGQLRAIAPYLPRGESSKLQPYFYEMILYDYLKNDQSAFLGL
IREWNPPPELFNVTTIINAVVDHLIIYDPENRFLLQALADLYSYQKKFGKALAMYLKLQD
PQVFSLIQRYGLYEEIESCIEDLMHLNVSEAINLFMKHKERLTPSIVISRLEGNRYYQYL
YLDVLYKGEGKDMKPEFNGMMVSLYADYGPSYLLQFLKSSDSYPIQEALDICKQRKLYAE
MIFLLGRMGNTKEALRLIIYVLDDIYQAIDFCKEHDDTELWEDLINFSLDKPSYITILLC
NIGTYVDPRILIQKIENGREIPGLRDCLVKILQDYNLQMELQEGCKNILVGDCLSLFQTL
VRTQLKGACLEEDQECGSCHKGILVGDNSGEDSNLLYFFCKHIFHVSCISSFDYQNCIIC
NLPRRATGLLEKL
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atggttggtgatgaaagggataaggggatgagcagcatggaggactatgacgattttgag
tctggaagcctgggggactctgcctccttggatggagttgatgacgatgaagacgaagaa
gacgatgaggaggaacccaagctcaactttatccgaattcgcaatgaccttttaggcata
ttggaaaaggacgccgtgagttgtgttgcagtacattccaagttcttgtgcatcggaagt
catcgaggagagctgtacattatggaccacttgggaaacaatgtgacaccttctccgaga
ggatcctttcctgcccacaaaataatgataaactgtatttccattgatgccgagggtgaa
catattgcaacttgttccgatgatggcaaagtcattgttttcaatctttgtgatggtcat
tgcgagactaccctttccttggacaagaaacttcgatgcgtggcaattgatcctcagtac
agtaaaagcagctttagtcgaagatttctagtcggaagtgatagtgccatgctttaccaa
agaaacatttttaacttgctaaagccattccccattttggaaggaggcattgtttccacg
attaaatggggcagtcgtttcgttgcgtggagttggaaggacgaagttcgaatctacgat
atcgaagaggaaataatgataagccgtgttagattcgagtgggaaagcaacaacctcgtc
aacaacagcttgatagagccttcttccttacatatgtccagcaatgggtcaaaggagaat
ctaattaaaactttgcatgaaaaatatcggtgcaatattttttggaaggataaatacacg
gtgtttattggatgggctgacataatcaagatttgtcaagtggtggaaattaaaaataaa
aacattcaacctggtgctccttctcactacgtgaagatctcttgcatgttcacgaccgac
ttctggacctgtggaatttcttcctttagtaattacaccactgtgctatccctcacaaaa
gagtttatggccattggaaatggtgacactaataatgaatatgcaaaaaataataaccta
ccaaacgtccaaattttggagacagacacaacctcttataatgtgctacaagcggacgca
cttcgtactcgaggatacacagaatacaaaccgttagattatcatttagaatcccttata
gacgaaattttattcttcattgtgtccccaaaggatattattcttgctaaagcaagggat
caggatgaccatattcaatggctaatggagcgcaaaaaatttgaagaggctctagaagtg
gccattcaggatccaaaatcattacaacggcattcagtcatgaatgtgggactggcatac
ttggatcatctcgttgaaaatgaaatgtttgcagacgctggaaagttgtgttttaaactt
tttggcaaagaaagcccagaaaaatgggaagaacaagttctcagatttgtcccccatggg
caactcagagcaatcgcaccctaccttccccgaggagaatcgtccaaacttcagccatat
ttttatgaaatgattttatatgactaccttaaaaatgaccagagtgctttcctcgggctc
atccgagagtggaacccacccccagagctgtttaatgttacaaccatcatcaatgctgtc
gttgatcacttaattatttatgacccagaaaatcgattcctcctccaagcccttgcagat
ctgtattcataccaaaagaaatttggaaaagctttggcaatgtacttgaagttgcaggac
cctcaggtattttcgttgattcagaggtatggactctatgaagaaatagaaagctgcatt
gaagacctcatgcatttaaacgtcagtgaagccattaatcttttcatgaaacacaaggaa
cgcttaacgccatccattgtaattagtcgacttgaaggaaacagatattatcaatacttg
tatttggacgtgctatacaagggagaaggaaaagacatgaaacctgagtttaatgggatg
atggtttcactttatgccgattatggtccctcttaccttcttcaatttctcaagtcatca
gacagctaccctattcaagaagccctagatatttgcaagcaacggaagctatatgctgaa
atgatttttctattggggcgaatggggaacacaaaagaggctttgcgtttaattatttac
gttctggatgatatttatcaagcgattgacttttgcaaagaacatgatgatacggagcta
tgggaggacttgattaatttttcactggataagcctagctatattacaattttattatgc
aacattggaacatatgtcgatccccgcattcttattcaaaagattgaaaacgggcgagaa
attccaggattacgagattgtttggttaaaattttacaggactacaatctacagatggaa
ttgcaggagggttgcaaaaacatcttggtaggcgactgcttgtcattatttcagacattg
gttaggactcaattgaagggggcttgtttagaagaagatcaagaatgtgggtcatgccat
aaaggaatattagtcggagataattctggtgaagattccaatttgctctatttcttttgc
aaacacattttccatgtttcgtgcatatcgagctttgattaccagaactgtatcatttgt
aatctcccacgacgtgcgactggtcttctggagaaactgtga

DBGET integrated database retrieval system