KEGG   Folsomia candida: 110847999Help
Entry
110847999         CDS       T05043                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
fcd  Folsomia candida
Pathway
fcd00350  Tyrosine metabolism
fcd00360  Phenylalanine metabolism
fcd00380  Tryptophan metabolism
fcd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    110847999
   00360 Phenylalanine metabolism
    110847999
   00380 Tryptophan metabolism
    110847999
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fcd04147]
    110847999
Enzymes [BR:fcd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     110847999
    4.1.1.105  L-tryptophan decarboxylase
     110847999
Exosome [BR:fcd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110847999
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC SepSecS Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 110847999
NCBI-ProteinID: XP_021950777
Position
Unknown
AA seq 479 aa AA seqDB search
MEADEFRDFGEAMLKYITDYLENIRDRRVLPTVKPGYLRDLIPEEAPEDGEKWQDIMKDI
ERVIMPGVTHWHSPHFHAYYPTANSYPAIVADMLSGAIACIGFTWIASPACTELEVVMMD
WLGKLLDLPAKFLASGSDGKGGGVIQGTASEGTLVALLSARARTVKAYAKTSGYDESTFL
GRLVAYTSDQSHSSVERASLLGGIKMRIVKTDGSLSMRGDVLKATILEDKAKGLIPFFVV
ATLGTTNSCAFDNLDEIGDVCVEQKIWLHVDAAYAGSAFICEEYRYLMTGVGKADSFNFN
PHKWLLVNFDCSAMWVANANELVDAFNVDPLYLKHDMQGKAPDYRHWQIPLGRRFRSLKL
WFVMRSYGSKKLQEHVRGQIALSHEFKKLVMQDARFEISAPVVLGLVCFRMNNKSEEDNE
KLLKSINERGKIHIVPSKLHGLYILRFAVCSRFTTSKDVEFAWKEIQDATTDLFETKST
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggaggctgacgagtttcgggattttggagaagccatgttaaaatacatcacggactac
ttggaaaacattagggacaggcgagtgctccctacagtgaaacctggctatcttcgtgac
ctgattcctgaagaagctccagaggacggggagaaatggcaggatatcatgaaggacatt
gagagggttataatgcccggagtcacccactggcattctccacattttcatgcatattat
cccacggcaaactcgtaccctgcgatagttgcggatatgctttctggggcaattgcatgc
attggatttacttggatcgcaagtccagcctgcacggagctggaggttgtgatgatggat
tggctgggaaaacttttggaccttcctgcaaagttcttggcatcagggtctgatggcaaa
ggtggtggtgttatccaggggacggcttcagaaggaacgttggtggctttactgtctgcc
cgtgctcgaacagtgaaagcctatgcaaaaacttcgggatatgatgaaagcacattttta
ggaagacttgttgcatacacttcggatcaatcccattcttccgttgaaagagcatctctt
cttggaggaatcaagatgagaattgtgaaaactgatggcagcctatcaatgcgaggggat
gtactgaaagctaccatcttggaggacaaagctaaagggctaattccattttttgtggtt
gcaactttggggactacaaactcttgtgcattcgataatcttgacgaaattggagacgtc
tgcgtggaacaaaaaatttggttgcatgttgatgcggcctatgcgggatctgcatttatt
tgcgaagaatatcgctatcttatgacgggtgttggcaaagctgactctttcaatttcaac
ccgcacaaatggcttttggtcaattttgattgttctgcaatgtgggtagcaaatgctaat
gaactggtggatgcgtttaatgtggatccgctgtacttgaagcatgacatgcaagggaaa
gcacccgattatcggcattggcaaatccctctgggaagacgatttcgttcactgaagttg
tggtttgtgatgagatcgtatggatcaaaaaaactgcaggagcacgttcgtggacagata
gcattgtcacacgagtttaagaaactcgtaatgcaagacgcccgatttgaaatatcagct
ccagttgtgctgggcttggtttgtttccgcatgaacaacaagtcagaagaggacaatgaa
aagcttttgaagagcatcaacgagcgagggaaaattcacattgttccctcaaagttgcat
ggattgtacattctccgttttgcagtgtgctctcgtttcacgaccagcaaggacgtcgaa
tttgcatggaaagaaatacaggatgctacaactgatctgtttgaaaccaaatcgacctag

DBGET integrated database retrieval system