KEGG   Folsomia candida: 110848111Help
Entry
110848111         CDS       T05043                                 

Definition
(RefSeq) palmitoyltransferase ZDHHC3-like
  KO
K20029  palmitoyltransferase ZDHHC3/7/25 [EC:2.3.1.225]
Organism
fcd  Folsomia candida
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fcd04131]
    110848111
Enzymes [BR:fcd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     110848111
Membrane trafficking [BR:fcd04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    110848111
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC DUF808 DUF1272
Motif
Other DBs
NCBI-GeneID: 110848111
NCBI-ProteinID: XP_021950924
Position
Unknown
AA seq 301 aa AA seqDB search
MHLRKDPCGIICIFITYAAVFYADYVVCRWIVLTVFDGSLWGCFHIILFNIIITFLTMAH
LRAVLSDPGIVPLPQTRVDFSDYHDNVEQQKSFLGPGSNDGGGPPGSESEHGTWTVCTRC
EAYRPPRAHHCRICKRCVRRMDHHCPWINNCVGEFNQKYFMQFLFYVGVLSMYSMALIVY
CWVNSTDDLKICLHCPKEDLLTKQSRILHTVILMLESMLFGLFVLAIMIDQISAIFSDET
AIEQAKKLGRHRVRKQPKMFLMEEVCGKGSFIYWFIPCRSDAHTRHIASSSNYKYGNRLD
V
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcacttgaggaaagacccttgtggtattatttgtattttcatcacgtatgctgcagtc
ttttatgcagattacgttgtatgcagatggatcgttctcacagttttcgatggaagttta
tgggggtgctttcacattatcctgttcaatataatcatcacatttttgacaatggctcat
ctcagagccgttttgtccgatcctgggattgtccctttgccgcagacgagagtggatttt
tcagattatcacgataacgttgagcaacaaaaatcttttttggggccggggtcaaatgat
ggaggtggaccaccagggtccgagtcagaacatggaacttggacagtttgcactcggtgt
gaagcatatcgtcctccaagggctcaccattgtcgaatttgtaaacgatgcgtccgccga
atggatcatcactgcccatggattaacaactgcgtcggggaattcaaccagaaatatttc
atgcaatttttattctacgtgggtgttctatccatgtattcaatggcattaattgtatat
tgctgggtcaactccaccgatgatttgaagatttgcttacattgtccaaaggaggattta
cttaccaagcagagtcgaatattgcacacagtgatattaatgctggagtcaatgctattt
ggactcttcgtattggctatcatgatagatcaaatatctgccatattcagcgatgaaact
gcgattgaacaagccaagaaattgggacgtcatcgggttcgaaagcagccaaagatgttc
ctgatggaagaagtttgtggaaagggttcctttatttactggtttatcccttgtcgaagt
gacgcacacacacgacacattgcatcctcaagtaattataaatatggaaatcgattagac
gtttaa

DBGET integrated database retrieval system