KEGG   Folsomia candida: 110848599Help
Entry
110848599         CDS       T05043                                 

Definition
(RefSeq) D-erythrulose reductase-like
  KO
K03331  L-xylulose reductase [EC:1.1.1.10]
Organism
fcd  Folsomia candida
Pathway
fcd00040  Pentose and glucuronate interconversions
fcd01100  Metabolic pathways
Module
fcd_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110848599
Enzymes [BR:fcd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.10  L-xylulose reductase
     110848599
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase RmlD_sub_bind NAD_binding_10 THF_DHG_CYH_C RNA_pol_Rpb1_4 NAD_binding_7 Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 110848599
NCBI-ProteinID: XP_021951536
Position
Unknown
AA seq 243 aa AA seqDB search
MNYSFKDKKILVTGAGRGIGRDVVITLAKQGATVYALSKDADNLKTLVEQFPSLIKPIQC
NLRDWDETEKVIANIEPLDHLVNNAGVAYRENFFEIKSDAFDEIFDVNVKAVVNVTKNVA
KKMVSSGKQGSIVNVSSVSALKQAPGLLSYCTSKAAVDMITKCSAIELAPHKIRVNSVNP
TIVMTDMGHDLWDDITTQALARIPLNSFAETTHCTNAILFLLSDLAGMTTGEFFLVDGGV
AAN
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaattattcttttaaagacaaaaaaatattggtcactggggctggcagaggaatcggt
cgagatgtcgtcataactttggctaaacaaggcgccacggtgtacgccttgtcgaaagat
gccgacaatttgaaaactctcgtcgaacaattcccctctcttatcaagccaatccaatgc
aatcttcgggattgggacgagacggagaaagtcattgcaaacattgagccgttggaccat
ttagtgaacaatgcgggggtggcgtacagggaaaacttttttgagataaaatccgacgct
tttgacgaaatattcgacgtgaatgtcaaagctgtggtaaacgtgacaaaaaatgtagcc
aagaaaatggtgagctcaggaaaacagggatcgattgtgaacgtttcttccgtgtcagct
cttaaacaagcacctggattgttatcctactgcacttcgaaagcagctgtggacatgatc
acaaaatgcagtgcgattgaacttgctccccacaaaatcagggttaattcggtcaacccc
accatcgtaatgacggacatgggacatgatttatgggacgacataactacgcaagccctg
gccagaattcctttgaattcatttgctgaaacgactcattgtacgaacgctattttattc
ctgctcagtgacctggctggaatgactacgggagaattttttctggtggatgggggagtg
gctgctaattaa

DBGET integrated database retrieval system