KEGG   Folsomia candida: 110849162Help
Entry
110849162         CDS       T05043                                 

Definition
(RefSeq) chitooligosaccharidolytic beta-N-acetylglucosaminidase-like
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
fcd  Folsomia candida
Pathway
fcd00511  Other glycan degradation
fcd00520  Amino sugar and nucleotide sugar metabolism
fcd00531  Glycosaminoglycan degradation
fcd00603  Glycosphingolipid biosynthesis - globo and isoglobo series
fcd00604  Glycosphingolipid biosynthesis - ganglio series
fcd01100  Metabolic pathways
fcd04142  Lysosome
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    110849162
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    110849162
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    110849162
   00604 Glycosphingolipid biosynthesis - ganglio series
    110849162
   00511 Other glycan degradation
    110849162
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    110849162
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:fcd03110]
    110849162
Enzymes [BR:fcd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     110849162
Chaperones and folding catalysts [BR:fcd03110]
 Intramolecular chaperones
  Others
   110849162
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b P53_TAD
Motif
Other DBs
NCBI-GeneID: 110849162
NCBI-ProteinID: XP_021952233
Position
Unknown
AA seq 635 aa AA seqDB search
MMFLVKLLSVFISFTICQQVASKLPPSHFQKSPWTWVCRERKCTKLDSTQVPPTETGHPL
NVCKLNCGEYGSLLPKPTIKTEIGAGFVPFYPNNVKFEKLEGPSPRTKRLLNASVDIFKS
YMLQSVSRYAEDGEDPFPENSTEYDRLSKNIVKVSIAIAHPFDKLTLNTDEGYLLSVQQQ
EDGATVIVTIQANTYFGARHALETLSQLIAYDDSKNCLQIVDRALIQDKPIFRYRGILLD
TSRNFIPVPKLRRLIDGMSYSKLNMFHWHITDTHSFPLYSKSVPQLTKYGAYSPKQIYTI
EDIAGLIDYATIRGVKIVAEFDAPAHVGNGWQFGPSAGKGELAVCINQEPWTEYCVEPPC
GQLNPVNEEMYKILSEVYKDMLDVFDNDVFHMGGDEVNVKCWNSSSTITQYLTNHGKDLS
QESFVELWGQFQIRALKLLKARSKDANMTAIMWTSDLTTKEHIKQYLDKKDYIIQIWSEG
RDPIIPYLINEGYRVIFSNYDAWYFDCGYGGWVGGGPNNWCSPYKGWQQVYGNSPIDIYA
NATSQADANQAMKQGLILGGEVAMWTEQADGSSIESKIWPRAAALGERLWSNPTTDWSAA
EIRMVANRQRLVDRGLDADQLQPEWCRQNEGLCHA
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgatgtttctcgtgaaacttttgtccgtgttcataagtttcaccatttgtcaacaagtt
gcgtcaaagcttcctccgagccactttcagaagagtccttggacttgggtttgcagggaa
cgaaaatgcacaaaacttgattcgactcaagtccctccaacggagactggtcatcccttg
aatgtctgcaaactgaattgtggtgaatatgggtctttattgccaaagccaactatcaag
actgaaattggagcaggtttcgtaccattttatccgaacaatgtcaagttcgagaagctt
gaaggaccatcgccacggacaaagagattactaaatgcatccgttgatattttcaagtct
tacatgttgcagagtgtttcccgttacgctgaagatggagaggacccatttccagaaaac
agtactgaatacgaccgtctttctaagaacattgtcaaagtcagcattgccatcgctcac
cccttcgataagttgacgttgaacacggatgagggttatttgctttcggttcagcagcaa
gaagatggggcaactgtaattgttaccattcaagcaaatacatattttggggctcgacac
gcgttggaaactttgagtcagttaatcgcttatgatgactccaaaaattgtctccagatt
gtggatcgggctcttattcaggacaagccgattttccggtacagaggaattctccttgac
acctctcgaaatttcatccccgtgccaaagcttcgcagacttattgacggaatgtcgtac
tcaaagttgaacatgtttcactggcacatcacggacactcattcctttcccctctactca
aaaagtgtcccgcagttaacaaaatacggagcgtactctccaaaacaaatttacacgatt
gaagatatcgctggactcatcgattatgcgactattcgaggggtgaaaattgtcgctgaa
tttgatgccccggctcacgttggaaacggttggcagttcgggccgtcggctggaaaaggt
gagctcgcagtttgcatcaatcaggaaccttggacagaatactgcgtggaaccaccgtgt
ggccaactgaacccagtaaatgaggaaatgtacaaaatattgagtgaagtttacaaggac
atgttggacgtgtttgacaacgacgtgttccacatgggtggcgacgaagtgaacgtcaaa
tgctggaacagttcatctacgatcacacaatatttgactaatcatgggaaagacttgtcg
caggagagctttgtcgagttatgggggcaatttcagatcagagcattgaaactgctcaag
gcccgttccaaggatgcaaatatgacggccataatgtggacgtcggacttgacgacgaag
gagcatatcaaacagtatcttgacaagaaggactacattatacaaatctggagcgaagga
cgtgatccaataattccatacttgatcaatgaagggtatcgagtcatcttttcaaactat
gacgcctggtatttcgactgtgggtacggaggctgggttgggggcggtcccaataattgg
tgctctccgtacaaagggtggcaacaggtttatggtaacagtccaattgacatttacgca
aatgcgacaagtcaagcagatgcaaatcaggccatgaaacaaggactaattttgggcgga
gaggtcgcaatgtggaccgaacaggctgatggttcgtccatcgagagcaaaatttggcca
cgagctgcagccttgggagagcgattgtggtcaaaccccaccaccgactggtcagccgcc
gagattcgcatggtggccaatcgacagcgtttagttgaccgtggactggatgctgatcag
ttgcaaccggaatggtgtcgccaaaatgaagggctgtgtcatgcatga

DBGET integrated database retrieval system