KEGG   Folsomia candida: 110850426Help
Entry
110850426         CDS       T05043                                 

Definition
(RefSeq) geranylgeranyl pyrophosphate synthase-like
  KO
K00804  geranylgeranyl diphosphate synthase, type III [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
fcd  Folsomia candida
Pathway
fcd00900  Terpenoid backbone biosynthesis
fcd01100  Metabolic pathways
Module
fcd_M00367  C10-C20 isoprenoid biosynthesis, non-plant eukaryotes
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    110850426
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:fcd01006]
    110850426
Enzymes [BR:fcd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     110850426
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     110850426
    2.5.1.29  geranylgeranyl diphosphate synthase
     110850426
Prenyltransferases [BR:fcd01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   110850426
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-GeneID: 110850426
NCBI-ProteinID: XP_021953550
Position
Unknown
AA seq 361 aa AA seqDB search
MSPQKESSPLLQDFDKTVETPDTKAEDDIRKEYSIDPKYTEIILQPFEYYQKLPSKNIRR
KIADIFNYWYRCSKEDIDRASTAMHGLHNASLIIDDIEDGSDMRRGQPAAHIQFGVPLAL
NAANYVYFDSVKRIIEEKNDEATPEDRLKATLEFVNAMMVMHVAQGMEIFWRDENLKGTN
SKDSKTFQHIPTEQEYFDIIVKKTAGQFVMLSESLKERSKTLYKDQPALSAHVLASSMGY
HFQIRDDLLNLISNTYEAGKGFCEDITEGKYSFPIIYTLNRYHEKDGIGIDKAARLLEIL
RMRTTDRALKKEAYDIIEESGAFEYTKNVLREYHGKIGREVLRLGGNPVFVEHMDIFAEV
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtccccccaaaaagaaagctccccactcctccaagatttcgataaaacagtcgaaacc
ccagataccaaggctgaagacgatatccgcaaagaatactcaatcgatcccaaatacacg
gaaattatcctccaaccattcgaatactatcagaaactcccgtcaaaaaatatccgcaga
aaaatcgccgacattttcaattattggtacagatgttccaaagaggacatagatcgtgcg
agtaccgcaatgcacggacttcataacgcgagtttaataattgacgacattgaagatggc
agcgatatgcgtcgtggtcaacccgccgcccacattcagttcggcgttcctctcgctctc
aatgcagccaactatgtttactttgactctgtgaagcgcataattgaagagaagaatgac
gaagcgacgcccgaagacaggttgaaggcgaccttagaattcgtgaatgccatgatggtc
atgcatgtcgctcaagggatggagatattctggcgagatgagaatctcaaagggacgaat
agcaaggattctaaaacattccagcacatcccaacggaacaagagtactttgatatcata
gtaaaaaagactgccggacagttcgttatgctctcggaaagtctgaaggaaagaagtaaa
actttgtacaaggatcaacccgcactttccgcacacgtgttggcgagcagtatgggatat
cactttcaaatcagggatgaccttctgaatctcatctcaaacacgtacgaagctggaaaa
gggttttgcgaggatatcacagagggaaagtacagctttcccataatttacacgctgaat
cggtaccacgaaaaggacggtattgggattgacaaagcggcacgactccttgaaatcttg
aggatgaggacgactgacagagccttgaagaaggaggcgtacgacatcatcgaggagtcg
ggagcattcgaatatacaaagaacgtgctcagagagtatcatggaaaaattggcagggaa
gtgttgcgattgggcggaaatccggtatttgtggagcatatggatattttcgcagaggtt
ttctaa

DBGET integrated database retrieval system