KEGG   Folsomia candida: 110850723Help
Entry
110850723         CDS       T05043                                 

Definition
(RefSeq) hydroxyproline dehydrogenase-like
  KO
K11394  hydroxyproline dehydrogenase [EC:1.5.5.3]
Organism
fcd  Folsomia candida
Pathway
fcd00330  Arginine and proline metabolism
fcd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    110850723
Enzymes [BR:fcd01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.3  hydroxyproline dehydrogenase
     110850723
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_dh Tnp_P_element Cyclin_C
Motif
Other DBs
NCBI-GeneID: 110850723
NCBI-ProteinID: XP_021953943
Position
Unknown
AA seq 485 aa AA seqDB search
MRLCKKVCNPLFAPWNRALFCTSTAANHSKIPLKAEFVTPTSASIGQIRNQFASWIAIGS
YKPGLLSHLSTPDIMRALFVLRTCSYDFVVSRSIQLFNISTKFGPLGEWGLRKTFFNQFV
GGDTLPGMKLTVESMQRRGLVLMVAPVLEEDIEDEQSSQKTYDDNLQSLLNLANMTSALE
KKKPIIQLKPTAIMPAITLEKVSKAMTQYLEDKKVTHATLISQLANCIEHPKNLELKLSN
EDKSQFLDGLQRADVFVKHCRDLKVHVLVDAEFYSCKPAISAIALILMARHNGDYHHVGN
TIQAYLKDAVQTIESELKTVTEDIGVNWYGKIVRGAYMDRERYLADKNGYISPVCDTYEA
TNISYNKAVKTVLKNLSQNPKKKSHLLVASHNEVSIRLAAQAMKDYEISANDDRVSFAQI
YGMADYLSTPLVSKNYHVYKSTPYGPIVKVLPYLARRASENRSVMMGAREERDMLWKELK
MRFKM
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgagactgtgcaaaaaagtttgtaatccactgtttgcaccatggaatcgagcactattc
tgtacatctactgctgcaaatcattcaaaaatacctttaaaagccgaatttgtgactcca
acaagtgcatcaattggtcaaatacgaaatcagttcgcttcctggattgcaatcggttca
tataaacctggtcttttgtctcacttatcaactccggacattatgagagccctctttgtc
ttgaggacgtgttcttatgattttgtcgtctcaagaagcatacagttatttaatatatcc
acaaaatttggaccgcttggagaatggggtttacgaaaaacatttttcaaccaatttgtg
ggaggcgacactctgccaggaatgaaactgactgtggaatccatgcaacgacgcggtctc
gtcctcatggtggcccccgtcttggaggaagatatcgaggacgaacaatcctcacagaaa
acatacgacgataatttgcaaagcttactgaatttggccaacatgacttcagctcttgag
aaaaagaagccaatcattcaactaaaaccaaccgcaatcatgcctgcgataacattggag
aaagtgtccaaagccatgactcaatatttagaggacaaaaaagtaacacatgcaacgctg
atttcgcaacttgcaaattgcattgaacatccgaaaaaccttgaattgaaactgtctaat
gaggacaaaagtcaattcttggatggattacagagggcagatgtttttgttaaacactgc
cgagacttgaaagttcatgtcctcgttgacgcagaattctactcttgcaaaccagcaata
tcggccatagctttgatcctaatggcacgtcataatggggactatcaccacgtgggaaac
acgattcaagcctatctaaaagatgctgtccaaacgattgagtccgaacttaaaactgtc
actgaggacatcggtgtcaactggtacgggaaaattgtgcgtggtgcttacatggacagg
gaaagatatctagcagataagaacggctacatttcacccgtttgcgatacctacgaagct
accaacatttcctataataaagctgtgaaaactgtattgaaaaatttgtctcaaaatcca
aagaaaaagtcgcatctgttggttgcatctcataacgaggtgtcaatccgattagctgcg
caggccatgaaagattatgaaatatctgccaatgatgacagagtgtcatttgctcaaatt
tatggaatggcagattaccttagtactccattagtgagcaagaactaccacgtgtacaag
tcaacgccgtacggacctattgtcaaagtgttgccatatttggccaggagagcatcggaa
aatcggtccgtgatgatgggtgccagagaggaacgtgacatgctatggaaggaattaaaa
atgcgtttcaaaatgtga

DBGET integrated database retrieval system