KEGG   Folsomia candida: 110851604Help
Entry
110851604         CDS       T05043                                 

Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic-like
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
fcd  Folsomia candida
Pathway
fcd00450  Selenocompound metabolism
fcd00970  Aminoacyl-tRNA biosynthesis
fcd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    110851604
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    110851604
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:fcd01007]
    110851604
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:fcd03016]
    110851604
Enzymes [BR:fcd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     110851604
Amino acid related enzymes [BR:fcd01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   110851604
Transfer RNA biogenesis [BR:fcd03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    110851604
 Prokaryotic type
   Other AARSs
    110851604
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g WHEP-TRS tRNA-synt_1 GST_N_5 HD_6 Anticodon_1 GST_C_2 HypA
Motif
Other DBs
NCBI-GeneID: 110851604
NCBI-ProteinID: XP_021955150
Position
Unknown
AA seq 933 aa AA seqDB search
MDHQNQTIKIITNTGNPASLKPLIAASLYGFKVALESVSVSPDGKQRPRLPVLVANEKTK
LFDTNVMVTYLLELAGIPHPSANLLNLLNFEAHSLFPLVLSYLLEKADTDFGVGKELLNV
LVELERRLKGESFFSGNVKPDIEDAIVWATLYPLFSANDKITKKCPLLLKWYILVESADL
TKAAVNLLQPVSGREAAKQILVCNPTASISLYGEKIKMEKLKLDDLPGGDATSTAVSSEE
IQLARESWVRPTPTSAVKSKRAGRILPLAGQKNYFITSALPYVNNVPHLGTIIGCVLSAD
VFARYCRIRGRNTLYICGTDEYGTATETKALEENLTPQQICDKYHKLHKEIYDWFDISFD
YFGRTTTKEQTEVGQEIFLKLWNNGFLKEMVVQQLFCNPCKRFLSDRFVEGTCPACAYED
ARGDQCDKCGRLTNSIELKNPRCKVCGSKDVTTKNSDQVFLDLPKLEEKVGLEEWLNRSS
EEWTSNARHIAKSWIREGLKERCITRDLKWGTPVPIEKYKDKVFYVWFDAPIGYISMTKC
YTKDYWKAWWMNPDPEIDIEYYQFMAKDNVPFHSILFPASLRGTKDPWTLVRHIMATEYL
NYEDGKFSKSRGVGVFGNDAIQTGIPADIWRFYLIFVRPENQDSAFSWDDFMLKNNSELL
NNLGNFINRSLTFLAKFFNSKIPPMNLNDDDFRVVAEINKEVSEYVNFLETCKLKDGLRK
ILAVSRIGNVYFQTQQPWTLNKNDQDLERCGTICGLGAQIVFLLMTLMEPFLPGVSRQIR
EQLNVPKPIFSKQLVPFLSVGHELGKVSPLFQKLDADFIAGLRKKYVGQQQPVEASPKKG
TAKAAPADSPLKPESNGVPGSPEEIAALEAAIALQGGVVRDLKAAKADKAALQPEIEKLL
KLKSDLSVKQGVDPKAAAAPAASSKSKGKSKKK
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atggaccatcaaaaccagaccattaaaatcatcacgaacacgggaaacccggcgtcgctg
aaacctcttatcgctgcatctttgtatggatttaaggtcgctttggaaagtgtgagtgtt
tcacctgatggaaagcaacgtccacgtcttcccgttcttgtggcgaatgaaaagacaaaa
ctgtttgacacaaatgtgatggtgacctacttactcgagttggcaggcattcctcatccc
agtgcaaaccttttaaatcttctcaattttgaagcacattcactctttcctcttgttctt
tcctacttgttggaaaaggcagacactgattttggcgtggggaaagaattgctaaatgta
ttggtcgagctggaacgaagattgaaaggggaaagcttcttttctggaaatgttaagcca
gatattgaagatgctattgtgtgggcaactctttatccattattctcggcaaatgataaa
attaccaaaaagtgtcctttgttactgaagtggtacattctcgtagagtcagcagatttg
actaaggcagcagtaaatcttctccaaccagtttccggaagagaagctgcaaaacaaatt
ctagtttgtaatcctactgcgtccatttccttgtatggcgaaaagattaagatggaaaaa
ttgaaactggacgatctcccgggtggtgatgctacctcgacagctgtatcgtcagaggaa
attcaactggctcgagaatcttgggttagacccaccccaactagcgctgtcaagtcgaag
cgagccggtcgaatcttgccactggctggacagaaaaattatttcattacatctgctctt
ccttatgttaacaatgttccccacttgggaacaataataggatgcgtattgtccgctgat
gttttcgctagatattgtcgaatccgtggtcgtaacacgctttatatatgtggaactgac
gagtatggaactgcaactgagaccaaagccttagaagaaaatttaacaccgcagcaaatt
tgtgacaagtatcacaaattacacaaagaaatctatgactggtttgacatctcctttgac
tactttggaaggacgacgaccaaggaacaaactgaagttggacaagaaatctttctgaaa
ttatggaacaatggatttctgaaggaaatggttgtccaacaacttttctgcaatccatgc
aagcgattcttatctgaccgtttcgtcgaaggaacttgtcccgcttgtgcctatgaggat
gctcgtggcgatcaatgcgacaagtgtgggagactcacaaattctattgagctgaagaat
cctcggtgcaaagtttgtgggtcgaaagatgtcaccacaaaaaatagtgatcaagtattc
ttagatttgccgaaattagaagagaaagttggtcttgaagaatggttgaaccgttctagt
gaggaatggacttcgaatgcaaggcatatagccaagagctggatacgtgaaggtctcaag
gaacgttgcatcactcgagacttgaaatggggaacacctgttccgattgaaaagtataaa
gataaggtgttttacgtgtggtttgatgcgccaatcggctacatcagcatgaccaagtgt
tatacgaaggactattggaaggcatggtggatgaacccggaccccgagattgacattgag
tactatcaattcatggccaaggacaacgttccattccattccatcctgttcccagcttct
ctacgcggaacgaaggatccctggaccctcgttcgccacatcatggcaaccgagtatctc
aactacgaggacggcaagttctccaagagtcgaggcgtgggagtctttggaaatgatgcg
atacaaacgggaataccagccgacatttggagattttatttgatctttgttcgacctgag
aatcaagattcggccttttcatgggatgactttatgctaaaaaataacagcgaactgctg
aataatctgggcaattttattaatagatctttgacatttttagccaagttttttaacagt
aaaattccacccatgaatttaaatgacgacgacttccgcgttgttgcagaaatcaataaa
gaagtctccgagtatgtgaattttctagaaacgtgcaagttgaaggatggacttcgtaaa
atattggcagtgtccagaattggcaacgtctatttccaaacacaacaaccatggactctc
aacaagaatgaccaagatctggagagatgtggaaccatatgcggtttaggggctcaaatc
gtattccttcttatgacacttatggaaccattccttcctggtgtaagtcgccaaattaga
gaacaactgaacgttccaaaacccatattttcgaaacaactcgttccattcctgagtgtc
ggacatgaattgggaaaggtttctccactcttccaaaaattggatgctgactttattgcc
ggccttcggaaaaagtacgttgggcagcagcagccagttgaagcttccccaaaaaaaggg
accgcaaaggctgcacctgcggactcacctttaaaaccggaatcaaatggagtccctgga
tctcctgaagaaattgccgctttggaagcagcaattgccttacaggggggcgtagttcga
gatttgaaagcggccaaagcagataaagccgcattacaaccagaaatagagaaactactc
aagctaaaatcagacctgagtgttaaacaaggtgttgaccccaaggcggctgcggctcca
gcggcgtcatctaaatcaaaagggaagtcaaagaaaaagtga

DBGET integrated database retrieval system