KEGG   Folsomia candida: 110856219Help
Entry
110856219         CDS       T05043                                 

Definition
(RefSeq) alkaline phosphatase-like
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
fcd  Folsomia candida
Pathway
fcd00730  Thiamine metabolism
fcd00790  Folate biosynthesis
fcd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    110856219
   00790 Folate biosynthesis
    110856219
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fcd04147]
    110856219
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fcd00537]
    110856219
Enzymes [BR:fcd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     110856219
Exosome [BR:fcd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110856219
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fcd00537]
 Enzymes
  110856219
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 110856219
NCBI-ProteinID: XP_021960381
Position
Unknown
AA seq 531 aa AA seqDB search
MSSTATVFILCIISQVVLGGNIYSDDHYMHPNFKRHVQNKQDPPFEDAEFWRKNAQDDLA
KELLKQPIEAQAKNVILFLGDGMSIPTVTAARIFKGQKVDGLPFGEEGQLHMDTFPFSGT
SKTFCMDTQVADSACSATAYLCGTKGRIGTIGVTSNVMIFQCAKQADPANHVSSVLAWAQ
AQGKSTGIVTTTGVTHASPAGTYAHAAFRSWESDADVRLGLGDPKVCEDIATQLIKREPG
ININVILGGGRRHFTPFTQNDTEYPDEKGHRLDGVNLIDEWISMKNSSRGRYVSGRDQLL
TVDPAETDYLLGLFAPSHVSYYDQQLANNDPTLEEMTEVAIKILSKNPNGFFLFVEGGRI
DHSHHNNAPQKAMWETIEFDKAIKKGDDMTEDDDTLIVTTADHSHVMYFAGYPDRGTPIW
KHSSDLALDGLPYSTLGYANGGNRNWLDETTNKRHNISQDNMDDLNYNPPVPVPMIDSES
HGGDDVAIFAKGPFAHLLTGVHQQSYIPHVIGSREFENGVNRTTPHNAKGV
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtacagcaacagtttttatactttgcataatttcgcaagtcgttttgggaggc
aatatttattcagatgaccactacatgcaccccaatttcaaacggcacgtccaaaataaa
caagaccctccattcgaagatgccgaattttggagaaaaaacgcacaagacgacttggca
aaggagcttctgaaacagcctattgaagcccaagccaaaaatgttatcctatttctcgga
gatggaatgtccatccctaccgtgacggctgccagaatttttaagggacagaaagttgat
ggattaccatttggagaggagggccaacttcacatggacacatttccatttagcggaact
tctaaaacattttgtatggacacacaagtggctgactcagcctgctcggcgaccgcttac
ctctgtggaactaagggtcgcattggaacaatcggggtcacttcgaacgtaatgatattt
caatgtgctaaacaagccgaccctgccaaccacgtgtcttccgttctcgcctgggcacaa
gcgcaaggaaaatccactggtatcgtaaccaccaccggcgtaacgcacgcctcccccgcc
ggaacgtatgcccacgcggctttccgatcttgggagagtgacgccgatgtccggcttggt
cttggcgaccccaaagtttgcgaagacattgcaacccaactcatcaaacgagaacctggc
atcaacattaacgtcattttgggcgggggtcgacgccactttaccccattcacgcaaaac
gacaccgaatatccggacgaaaaaggtcaccgtctcgacggagtgaatctgatcgacgag
tggatttccatgaaaaactcgtcccgaggaagatatgtttccggaagggatcaattgttg
accgtggatccggccgagactgactacctgctcggcctctttgccccctcacacgtttcc
tactatgaccaacaactggccaacaatgaccccactttggaggagatgacggaagttgcg
atcaaaattttgagcaagaatcctaacggatttttcctctttgtcgaagggggaaggata
gatcattcgcatcataataatgctcctcaaaaagcgatgtgggaaacgattgagtttgac
aaagcgattaaaaagggagacgatatgacggaggatgacgacactttaatcgtaacgacg
gcggatcactcgcacgtgatgtattttgctggctatcctgaccgaggcacacccatttgg
aaacactcttcagaccttgccctggatggtttaccctattcaactcttggctatgcaaac
ggtgggaatcgaaattggctggacgaaacgaccaacaagcgacacaacatatctcaagat
aacatggacgatctgaattataatcctccagttcctgttccaatgattgactctgaatca
cacggaggagatgatgtagcaatctttgccaaaggtccatttgcccacctgttgacaggg
gtgcatcagcaaagttatattccacacgttatcgggtctcgggagtttgaaaatggggtc
aatcggaccaccccccacaacgcgaagggggtatag

DBGET integrated database retrieval system