KEGG   Folsomia candida: 110857518Help
Entry
110857518         CDS       T05043                                 

Definition
(RefSeq) selenide, water dikinase-like
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
fcd  Folsomia candida
Pathway
fcd00450  Selenocompound metabolism
fcd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    110857518
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:fcd03016]
    110857518
Enzymes [BR:fcd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     110857518
Transfer RNA biogenesis [BR:fcd03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    110857518
 Prokaryotic Type
    110857518
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-GeneID: 110857518
NCBI-ProteinID: XP_021961799
Position
Unknown
AA seq 410 aa AA seqDB search
MEEVNGTVVHEAHLVAVEAPSEVETLELGGSGSLERRSFDPVAHELDATFRLTKYADLKG
NGCKIPQEDIAKLLKGIQDNPQDHVQLEGGVGCIGMDACISPLRYEGFCAVQTVDLFYPL
VDDPYIQGKIACAGVLSSLYAMGVTECDNMLMLMGVSTKLTDKERDVVVPLIMRGFKNTA
MEAGTNVRGGQTVLNPWLTVGGVASSICQSPEVIMPESALPGDVLVLTKPLGTHVAVTVH
QWSDLPDRWNRIKLVISQDEVRKAYNRAMDSMSRLNRTAATLMHKYGAHAATDVGGFGLL
GHAQNLARNQKAEVSFVIHNLPVIARMTAVSKACGTTFPILQGLSAETSGGLLICLPREQ
AAAFCKEIEKSEGYQAWIVGIVEKGNRTARVIDKPRVIEVPAKEKEGELW
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggaagaggtgaacggtacggttgttcacgaggctcacttggtggcggtggaagcccca
tcggaagttgagacgttggaattgggtgggtcaggatctctcgagcggcggtcgttcgac
ccagtcgcgcacgaactggatgcgactttccgtctcacaaagtatgcggatttgaaagga
aatggatgtaaaatcccccaggaggatattgccaaattgctgaaaggaattcaagataac
ccacaagatcatgtgcagcttgaaggaggggttggttgcattggtatggatgcttgcatc
agtccacttcgttatgaaggtttctgtgctgttcaaactgttgatttgttctatcctttg
gttgatgatccctacattcaagggaaaattgcatgtgctggtgtcctgagtagcttgtat
gccatgggggtgactgaatgtgacaacatgttgatgctcatgggcgtctctaccaaattg
actgacaaggagagagatgttgtcgttcctctaataatgcgagggtttaagaatactgct
atggaagctgggacaaatgttcgtggaggacaaaccgttctaaatccctggctgacggtt
ggtggggttgccagctcgatttgtcaaagtccggaagtgattatgcctgaaagcgctctc
cctggagacgttctagtattgacaaagccattaggtactcatgttgcagtgaccgtgcac
caatggtctgatttgccggatcgatggaaccgcatcaagttggtgataagtcaagacgaa
gttcgtaaagcatacaatcgagcaatggactccatgtcgagacttaatagaactgctgcg
actttgatgcacaagtacggtgctcatgctgctactgacgttggtgggtttggacttctg
ggccatgcacaaaaccttgctcgaaatcaaaaggcggaagtgtcattcgtcattcataac
cttccagtaatagctagaatgaccgctgtttctaaggcttgtggaaccacgtttccaatc
ttgcagggattatcggcagagacgtctggtgggcttttgatttgcttaccaagagagcaa
gccgcagcattctgtaaagagatcgaaaagtcggaaggttatcaagcgtggatcgttggt
attgtcgagaaaggaaatcgtacagccagagtcattgacaaacctcgtgtcattgaagtt
cctgccaaggagaaggaaggcgaattgtggtag

DBGET integrated database retrieval system