KEGG   Folsomia candida: 110858444Help
Entry
110858444         CDS       T05043                                 

Definition
(RefSeq) endoplasmic reticulum resident protein 44-like isoform X1
  KO
K17264  endoplasmic reticulum resident protein 44
Organism
fcd  Folsomia candida
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fcd04131]
    110858444
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fcd04147]
    110858444
Membrane trafficking [BR:fcd04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    110858444
Exosome [BR:fcd04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110858444
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin_6 Thioredoxin Calsequestrin
Motif
Other DBs
NCBI-GeneID: 110858444
NCBI-ProteinID: XP_021962919
Position
Unknown
AA seq 423 aa AA seqDB search
MTYSNRRPRNKEMSFMPQRSCSRKSWGIVLFYLVVISFYNPTDSGAVEFDESNFDATIAH
SELVFVNFYADWCRFSNLLAPIFDEAADKISGVFPDKTKVTLGRVDSDKHSSISSRYKIS
KYPTLKLIRNGVPVKKEYRGGRTPEAFLEYIVKQMENPIHEFHHLREVLSIDETKRIFIG
YMTSNTSRTYDTYRRVAMNLKDDCAFYVGFGEASRTMHPPDVDILAFRPDRTTSVELDET
FKGNSENFDEVLTWIQTKCVPLVREITFENAEELTEEGLPFMILFHNPDDKDSIRRYNQV
VHEQLMGEKHAITFLTADGKRFAHPLHHLGKSEKDLPLIAIDSFRHMYLFPDASQMDIPG
KLKNFIADLHSGKLHREFHYGPDPNSDPSNDLLTQPKGTSPPESTFKKLAPSSNRYTLLK
DEL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgacatatagtaataggcgaccaagaaataaagaaatgtcgtttatgccgcaacgatcc
tgctcaagaaaatcatgggggattgtcctcttctatctcgtagtgatctcattttataat
ccaactgacagtggagctgtagagttcgacgaatctaattttgatgctacaattgcacat
tcggagctcgtttttgtaaatttttacgccgactggtgtcgatttagcaaccttctagct
ccaatttttgatgaagctgcagacaaaatctctggtgtttttccagacaaaactaaagtc
actttaggaagagttgacagtgataagcacagctcgatttcatctcggtacaagatatca
aagtatccaacgctcaagttaattcgaaatggagttcctgtcaaaaaagagtatcgtggt
ggtcggacgccggaagccttcttggagtacatcgtcaagcagatggaaaaccctattcac
gaatttcatcaccttcgagaagttctcagcattgacgaaacgaaacgcatatttattggc
tacatgacttccaatacaagcagaacctatgatacttatcgccgagtcgccatgaatttg
aaggacgattgtgctttctacgttggatttggtgaggcatcacgcaccatgcaccccccg
gatgttgacattcttgctttccgaccagatcgaacaacttctgtagaactcgacgagaca
tttaaaggaaactctgaaaattttgacgaggttctaacatggattcaaaccaagtgtgtt
ccactcgtgagagaaatcacattcgagaatgcagaggaattgacagaggaggggctccca
ttcatgatcctatttcacaacccagacgataaggacagtattagacgctacaaccaagtt
gttcatgagcaattgatgggtgaaaagcacgccatcacgttcctcactgccgatggaaag
cgattcgcccacccccttcatcacttgggaaaatctgagaaggatttacccctcattgcc
atcgatagttttcgccacatgtacctttttccggatgcgagccagatggacattcctgga
aagttgaaaaactttattgcagatcttcattcgggaaaacttcaccgcgagttccactac
ggaccggaccccaactcagaccccagcaatgacttattgacccaaccaaaggggacgtcg
cccccagaatccacctttaaaaaattggccccttcctccaatcgatacactctactcaaa
gatgaattgtga

DBGET integrated database retrieval system