KEGG   Folsomia candida: 110859164Help
Entry
110859164         CDS       T05043                                 

Definition
(RefSeq) dipeptidyl peptidase 3-like
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
fcd  Folsomia candida
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fcd01002]
    110859164
Enzymes [BR:fcd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     110859164
Peptidases and inhibitors [BR:fcd01002]
 Metallo peptidases
  Family M49: dipeptidyl-peptidase III family
   110859164
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-GeneID: 110859164
NCBI-ProteinID: XP_021963729
Position
Unknown
AA seq 817 aa AA seqDB search
MQGRLLSLLRNSLVQVAKQQTRQTSYPNQSYLYHNNRRHSSSTLQFFRNYSHTTNSDSSV
PLARPKPDPATPTNTFISPLPLRNKAEQEDKATSKTAIMVDKVMKHYILPLDQPVVSLDC
SEAFEGLSQKEKLYSHYLSQGAWIGGLVVLVQTSPESPVIFSLLHDLFKSNGVEGLRSVA
IGECNFTEDEWKALTVYTSGIFASMGNYKGFGDTKFIPGVPCDKLSVLLNKAKFLGMGGK
DIEAKWEYVKDKMYTLGDREKQLGLGQKGVTTYFSANCSKEDSELVQRFLKKEKLEAWNT
RCFKMVDGASPLYEIRSASSELDEGPPKIFEFEGANIRLTKGDYAPLMALTAEYLEKAKE
FASNDTEKSMLECYAKSFQGGKVDMHKEGSRFWIKDKGPVIETYIGFIETYRDPTGVRAE
FEGFVAVVNRETSKKFGKLVDHASEFLKLLPWPKEFERETFMKPDFTSLDVLSFAGSGIP
AGINIPNYDEIRQNEGFKNVSLGNVIPASYKDSVIPFLSAADKEMLEKYRVPSFSVQVAL
HELLGHGSGKLLKKNDDGTLNYSPDLKNPLTGQLIERCYDHNDTYDSIFGDMGSAFEECR
AECVGILLSLDKTILKLVFGYEGEEADDIIYINWLSMIYAGGAKALEMYQPDTSQWMQAH
SQARFSILRVLVEAGEGLVHVEETVGSDGKPDLLITLDRSKIDTVGRKAISDYLLKIQVY
KATADIESAREMFGKLTAVNNEGKYPWASWREIVMDKKQPRKFFVQHNTVAEGETVSLKN
YETTPEGMIQSWIERFPDSKAVYKALDYNWLKDKHHF
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggtcgcttgttgtccctgcttagaaatagtttagttcaagtagcgaaacagcag
acccggcagacaagctatccaaatcaaagctatttgtatcataataatcgtcgtcacagc
tcctcaactctccaattctttagaaactacagtcacactacaaattccgatagcagtgtc
ccactcgcgcgaccaaagcctgatcctgctacacccacaaacacattcatctcaccccta
cctttgagaaacaaagcagaacaggaggacaaggcgacctctaaaactgctattatggta
gacaaggtcatgaagcactacattcttcctctcgaccaacccgtcgtctcgctcgactgc
agcgaggcattcgagggtctctcgcagaaagagaagctatattctcactatctcagccag
ggtgcctggattggaggactcgtcgtcttggttcagacctcgcccgagtctcccgtcatt
ttttccttgttgcacgacttgttcaagtccaacggggtggaaggactcaggtccgtggcc
atcggggagtgcaattttactgaggatgagtggaaggctctcacagtctacacaagtggc
atttttgcttcaatggggaactataaagggtttggtgataccaagttcatccccggggtt
ccgtgtgataagctttctgtactcttaaacaaggcaaagtttcttggaatgggaggaaaa
gatattgaagctaaatgggagtacgtcaaggataagatgtatacattgggggatcgagaa
aagcagttgggcctgggacagaagggagtgaccacatacttttctgccaactgtagcaag
gaagactctgagttggtccagcggtttttgaagaaggagaaacttgaagcctggaataca
aggtgttttaagatggttgacggggcgtccccattgtatgagattcgaagtgcttcctct
gaactcgacgaaggtcctccaaagatatttgaatttgaaggtgctaatatccgactgacg
aaaggagactacgctccccttatggccctcactgccgagtacttggaaaaagcaaaggag
tttgcatccaacgacacggaaaagagcatgctcgagtgctacgccaaaagttttcaaggg
ggcaaggtggacatgcataaggaagggtccagattctggattaaggacaaaggacccgtc
atcgagacatatatcggattcattgagacgtatcgtgatccgaccggagttcgtgctgaa
tttgaaggctttgtcgccgtggtgaatagagagacgtccaaaaagtttggcaaattggtt
gaccatgcctctgaatttttaaaattactcccttggccgaaagagtttgagcgtgagacc
tttatgaaaccggattttacttctcttgacgttctgagctttgctggaagcggcatcccc
gctgggattaatatcccaaattatgatgaaattcgccagaatgagggatttaagaacgtg
tcattgggcaatgttatcccggccagttacaaggatagtgtgatcccattcttatccgca
gcggataaggagatgctagaaaaatacagagttccttccttttcggtccaagttgctctt
cacgaactcctcggccatggttctgggaagttgctcaagaagaacgatgacgggactctc
aactactctccagacttgaagaatccactgactgggcaactgattgaacgctgttacgac
cacaacgatacgtacgactccatctttggcgacatgggatctgcattcgaagaatgtcga
gcggaatgtgtcgggattttgctatcgttggataaaacaattttaaaattggtctttggc
tatgagggtgaggaagcggatgacatcatttacattaactggctgtccatgatatatgcg
gggggtgccaaagctctggaaatgtatcaaccggacacaagccagtggatgcaggctcat
tcccaagctagattttctatcctgcgcgttctcgtcgaggctggagaggggttggttcat
gtggaggagacggtgggctcagatgggaaaccagacttgctcatcactttggatcggagt
aaaattgacaccgtaggtcgaaaggccatcagcgactatctcctcaaaatccaggtgtac
aaagctacggccgatatcgagtcagctcgtgaaatgtttggcaagttaactgcggttaat
aacgaggggaaatacccatgggctagctggagggaaattgtgatggacaagaagcagcca
agaaaattttttgttcaacataatactgtcgccgagggtgagactgtgagtctgaaaaac
tatgagaccacgcccgaggggatgatccagtcctggattgaacgcttccccgacagcaag
gccgtctataaagctctcgactacaattggctcaaagacaagcaccacttttaa

DBGET integrated database retrieval system