KEGG   Folsomia candida: 110861553Help
Entry
110861553         CDS       T05043                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
fcd  Folsomia candida
Pathway
fcd00010  Glycolysis / Gluconeogenesis
fcd00562  Inositol phosphate metabolism
fcd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110861553
   00562 Inositol phosphate metabolism
    110861553
Enzymes [BR:fcd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     110861553
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     110861553
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 110861553
NCBI-ProteinID: XP_021966379
Position
Unknown
AA seq 447 aa AA seqDB search
MWVKLFCGLVAVVAIILGVAVEWLSVGCHRGIQSPHQFLATKTPYLHPAQLRHHASHDSC
TPIQIWMVVRHGTRNPSAKVIRKIINLLPNVRDQIVKAHENGVGTLCPSDLDALKKWSPP
PSLTESNEKILVEQGREELRGIGRRFKDRFQNLLGKKYDNSTYKFKFTKTERAAASCKYF
VEQVVGEEDAPSVWYPEALAADPILRFYKGCPKWKKTVDKNPEAYNERKKFETSQIFESV
RRNVQTRTGSADPVPLEAIEGMYMTCAFETAWTPATSSPWCALFDVDDLEKMQYRQDLEY
YWIDGYGFELTYKQACPAVKDMVEHFKSKTESPNEGPSLIAYFTHSGTLLKLISRLGLFN
DSTPLLHDNYHLHTTRQWRTNEIDKFATNIAAVLYKCPTDNFKVGLLFQELPVSIPECGD
DLCPLDKFLSIYHSVLNDCDIPQMCQL
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgtgggttaagttattttgtggcttagtggccgtagtcgccatcattttgggagtggcc
gtcgaatggctgagtgtgggatgtcaccgtgggattcagtcaccacaccaattccttgcg
acgaaaacgccatatctgcacccagcccagttacgccatcacgcaagtcatgatagctgc
acaccgatacaaatatggatggttgtgcgtcatgggactagaaatccaagtgcaaaagtc
attcgcaaaattataaatcttcttcctaacgtccgggaccaaatcgtcaaggctcacgaa
aatggagtgggtaccttgtgtccttctgacttggacgctttaaagaaatggtctccacct
ccctcgctgacagagtctaatgaaaaaattttggttgaacaaggtcgcgaagagctgcga
ggaattgggcgtagattcaaggacagatttcaaaatttactggggaaaaagtatgacaat
agcacttacaagttcaaattcacaaagactgaaagagcggctgcaagttgtaaatatttt
gtagaacaagtcgttggcgaagaagatgctccatccgtctggtatccagaggctttagca
gcggatccaattttaaggttctataaaggttgtccaaaatggaagaaaaccgtcgacaag
aatcctgaagcgtacaatgaacgaaaaaagtttgagacgtctcaaatattcgaatctgtt
cggaggaatgttcaaaccaggacaggctcggctgaccccgttccattggaggcgatcgaa
ggaatgtatatgacttgtgcttttgaaacggcctggaccccagctacctcgtccccttgg
tgcgccctctttgatgtagacgacttggaaaaaatgcagtatcgtcaggatttagaatac
tattggatagatggatatggattcgagttgacatacaaacaagcatgccctgcagtcaag
gacatggtggagcatttcaagtctaaaactgagtctcctaatgaagggccttctcttatc
gcgtatttcactcatagtggaaccttactcaaattaattagtcgcctgggattgttcaac
gactccacgcccctgctccacgacaactatcacttgcatacaacaagacaatggaggacg
aatgaaattgacaagtttgcaaccaacattgctgcagttctctacaaatgtccaacagat
aacttcaaagtggggctgctttttcaagagctaccagtttctatacccgaatgtggcgat
gatctctgtccgttggataaattcttgtccatttaccactccgttctaaatgactgtgat
ataccccaaatgtgtcaactttaa

DBGET integrated database retrieval system