KEGG   Francisella cf. novicida Fx1: FNFX1_0218Help
Entry
FNFX1_0218        CDS       T01937                                 

Definition
(GenBank) Oxygen-insensitive NAD(P)H nitroreductase / Dihydropteridine reductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
fcf  Francisella cf. novicida Fx1
Pathway
fcf00633  Nitrotoluene degradation
fcf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fcf00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    FNFX1_0218
Enzymes [BR:fcf01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     FNFX1_0218
  1.-  
   1.-.-  
    1.-.-.-  
     FNFX1_0218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: AEB27166
Position
complement(217931..218584)
Genome map
AA seq 217 aa AA seqDB search
MNIVDYAKNRYTTKAYDPTKKLSNEQIQQIKDILRFTPSSVNSQPWHFILATSDQAKAKI
AKAAENIHPKNVTNIKDCALVIVFCLKTDIDDEYLELLLNQERKDGRFPTSEFENMQRDV
RRKFALAYKDKPQELQIWTEKQLYIALGNILLGLSALEINATPMEGIEPHIIDTEFNLAE
KGLKTSVIVTAGYSSEDDFNAKLPKSRLPEEKIFTEV
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaatatagttgactacgctaaaaaccgttatacaacaaaagcttatgatccaacaaaa
aaactgtcaaatgaacaaatacagcaaataaaagatatccttagatttacaccatcaagt
gtaaactctcaaccttggcactttatcttagcaacttctgaccaagctaaagctaaaatt
gctaaagcagctgaaaatattcatcccaaaaatgtaacaaacattaaagattgtgcttta
gtcatcgtattttgcctaaaaactgatattgatgatgaatatctagagctacttctaaat
caagagcgtaaagatggtagattccctacttcagaatttgagaatatgcaaagagatgtg
cgcagaaaatttgctctagcatacaaagataaaccccaagagttacaaatttggacagaa
aaacaactttatattgctcttggtaatattctattaggactatcggctttagagataaat
gctacacctatggaaggtatagagccacatataatagatactgaatttaatttagcagaa
aaggggcttaaaacctccgtaattgtcactgctggctatagctctgaagatgattttaat
gctaagctacctaaatcaagacttcctgaggaaaaaatctttactgaagtttag

DBGET integrated database retrieval system