KEGG   Francisella cf. novicida Fx1: FNFX1_1348
Entry
FNFX1_1348        CDS       T01937                                 

Definition
(GenBank) hypothetical protein
Organism
fcf  Francisella cf. novicida Fx1
SSDB
Motif
Pfam: IcmF_C
Other DBs
NCBI-ProteinID: AEE87734
Position
1380205..1383486
AA seq 1093 aa
MNFIKNHQILIISLTIAIIVLSVLGIFMIKKWLKTSRNPNKKSASKTIKNAKSLIKKNKV
KNNLSELYIFYGDYLAAKDYITKIKPQAQIIDNNELPLIAIDKNNTSLVFANNEFSYLYK
LKKKLNLQFYKLNFCFDISDDYYHENIKISEIYKELLKLRLKNFIISFYTLSENTRSYNN
AIDKKSIFKLTSDADTNHKAEEEILSKILSSKDDVNNKYNNVKILNQIRKLLKNIYPQLK
SINKEIFFNFGLNTPDNIIAKSDTIFFSSSPKGIIINLISLLFSFIFIINIFQEINIKEK
LSIQELNQPHESDSNKIIKEARKKIDDAILLDILYPKSIKYHFIYEQYADTLLKNVILPK
YNDTYDLSMITSFLIFFEYLDNKIINQHTNRILKIISSITNLSEKQLDIVIKYTTPSIRT
EMIKSAINRANKLYTNRLIVVGEDSESYLSTKGFNAEYLGISNTKRAKVINNIYIQYLYK
CATDNAILDLSDNYIIPTEVNNIFKMYQEQFDTSSKKLCNSSYINSITKSVSLILNQEEN
KRKFESFSDMLDHIYYLVKSLEKNAKDVADDGKEQTSSITVSLINYVINSIVNPTYNKNE
LPLINPVSKNLYMEFAPNFYSKRILISPIYSKEYIKDNIDPINKKFNRLVNNLKNNFNIE
PDFMIAIYKSSINNYIEKYIGSYNKMIDSLNNDSEFNKNISNKSALKLYLLAMSSKDSSF
NSLIEFYSTNTDLITNESETNSSKKINKLQHFYGEITKLNKQDNTNDQNDKSLWAPIDNY
FKENDKYLESKSYADYKNIFKQLNNLIIEQGYSSTYKNIKQGYEPLQKVYSELSKINNHQ
GNNNLYKLLKKHLDIAINAIKTIAIQDAITKLDNTVNIEYEYINNQFPFNKDSNSAATNE
AITKDFDNNGYIYSGFIEQLSPLLSYNKTDDRWESKDFSKPEEIDYLNKFNKVYLLNKLL
WDDKRNPKAIKFDITPIPNKDNDYTFFSIILDKQNYVNSLNIKYSDSIEVLYNWNSLEST
TITIKFEDGSNEQISYQGKWSILKAIKDANCDQNNICTWVIKHKGKKYPVSFKIESKFLQ
VLGWQKQGEVNVQ
NT seq 3282 nt   +upstreamnt  +downstreamnt
atgaattttattaaaaatcatcaaatattaataatttcactaactatagcaataattgtt
ttatcagtacttggtatttttatgattaaaaaatggcttaaaacatcaagaaatcctaac
aaaaaatctgcctcaaagaccataaaaaatgcaaaatcattgatcaaaaagaataaagta
aaaaacaacttaagtgaattgtatattttctatggggactatctagcagctaaagattat
ataacaaagataaaacctcaagctcaaatcattgataataatgaactccctttaatagct
attgataaaaacaatacatctctcgtatttgcaaataatgaattttcgtacctatataag
ttaaaaaagaaactaaatctacagttttataagcttaacttttgtttcgatatatccgat
gattactaccatgaaaatatcaaaattagtgaaatctataaagaactattaaaattaaga
ttaaaaaacttcataatatctttttacaccttgtctgagaatactagaagctataataat
gcaattgataaaaaatcaatatttaaattaacttctgatgcagatacaaatcataaagct
gaagaggaaatattatcaaaaattcttagctctaaagatgatgttaataataaatacaat
aatgttaagatattaaatcaaataagaaagttactaaaaaacatctaccctcaattaaaa
tctataaataaagaaatattctttaattttgggctaaacacaccagataatattatagca
aagagtgatacaatattttttagcagctctccaaaaggtattattataaacttaatatct
ttgttatttagttttatatttatcattaatatttttcaagaaattaacattaaagaaaaa
ctctctatacaagagcttaatcaaccacatgaaagcgactctaataaaataataaaagaa
gctagaaaaaaaattgatgatgctatacttctagatatcctatatccaaaatcgataaaa
tatcatttcatatacgaacaatatgctgatactctcctaaagaatgtaatcttaccaaaa
tataatgatacatatgacttatcaatgattacatcatttttaatattttttgagtatttg
gataacaaaattattaaccaacatacgaatagaatacttaaaataataagcagtatcacc
aacctatctgaaaagcagctagatatcgtgatcaagtatacgaccccaagtataagaact
gaaatgattaagtcagccatcaacagagcaaataaactttatacaaatcgtttaatagtt
gtaggtgaagactccgaaagttacttaagtactaaaggatttaatgctgaatacttaggg
atttcaaatactaaaagagcgaaggtcataaataatatttatatacaatacctatataaa
tgtgctacagataatgcaattttagatttaagcgataactacataataccaacagaagta
aataatatcttcaagatgtatcaagagcaatttgacacatcatctaaaaagctatgtaat
tcatcatatattaactctattacaaagagtgtttctttgatacttaatcaagaggaaaat
aaaagaaaatttgaaagcttcagtgatatgctagaccatatctattatttagtaaaatca
ttagaaaaaaatgctaaagatgtcgcagatgatggtaaagaacaaactagctcgataaca
gtatcgcttataaattacgttataaatagtattgtcaaccctacttataataaaaatgag
ctcccactaataaatccagtaagtaaaaacctatatatggagtttgctcctaatttctat
agtaaaagaatacttatctctccaatatactcaaaagaatatattaaagataatatagat
cctataaataaaaagtttaatagactcgtcaataatctaaagaataacttcaatatagaa
cccgactttatgattgctatctataaaagttctataaataactacattgaaaaatatata
ggatcctataataagatgattgatagccttaataatgactctgaatttaacaaaaatata
tctaacaagagtgctcttaaattatatttgctagcaatgtcatcaaaggattcttccttt
aatagcctaatagagttttatagcactaatacagacctaataactaatgaatccgaaacc
aattcatctaaaaagataaataagcttcaacatttttatggagaaataactaaattaaac
aaacaagacaatactaatgatcaaaatgataagtcattgtgggcgcctatagataactac
tttaaagaaaacgataaatatcttgagtctaagagttatgccgactataaaaatatattt
aaacagttaaataatctaataatagaacaaggctattcaagtacatataaaaatatcaaa
caaggatatgaaccactacaaaaagtttactctgagctttctaagataaataatcatcaa
ggtaataataacttatataaactgttgaagaaacatctagatattgccattaatgctata
aaaactatcgccatacaagatgctataactaaacttgataatactgtcaatattgagtac
gaatacataaataatcaattcccttttaataaggatagtaactcggctgcaacaaatgaa
gctataaccaaagactttgataacaatggttatatatactctggatttatagagcaacta
tctccactactttcttataataaaactgatgatagatgggaaagtaaagatttttcaaaa
cctgaggaaatagactatctaaataaattcaataaggtatatcttttaaataagctacta
tgggatgataaaagaaatccaaaagctataaaatttgatataactcctataccaaacaaa
gataatgattatacattttttagcataatcctcgataagcaaaactatgtaaactcatta
aacataaaatattcagatagtattgaagttttgtacaactggaattcacttgagtcaaca
actattaccataaaatttgaggatggtagtaatgagcaaataagctatcaaggaaaatgg
tctatattaaaagcaattaaagacgcaaattgtgatcaaaacaatatttgtacctgggta
atcaagcacaaaggtaaaaaatatcctgtaagcttcaaaatagaatcaaaattcttacaa
gtattaggctggcaaaaacaaggagaagttaatgtacaataa

DBGET integrated database retrieval system