KEGG   Falco cherrug (Saker falcon): 102045875Help
Entry
102045875         CDS       T02911                                 

Gene name
NIT1
Definition
(RefSeq) deaminated glutathione amidase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
fch  Falco cherrug (Saker falcon)
Brite
KEGG Orthology (KO) [BR:fch00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102045875 (NIT1)
Enzymes [BR:fch01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     102045875 (NIT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 102045875
NCBI-ProteinID: XP_027666037
Position
Unknown
AA seq 274 aa AA seqDB search
MYGSGGVWEVQGGSGSGVQGLGGSWGRRRRFDYIGSNMAETLSLAEGLDGDIMGRYAGLA
RDCGVWLSLGGFHERGQDWLTTQRIYNCHVLLDPTGRLVAAYRKTHLCDVELEGRVTMKE
SSFTNPGTEIVAPVSTPAGKLGLSICYDLRFPEISLALRRAGAEILTYPSAFTVPTGSAH
WEVLLRARAIESQCYVVAAAQTGKNHERRTSYGHALVVDPWGAVVAQCHEGPGLCYAEID
LDYLHRIRREIPVHGHRRPDLYGTVAAAGLVPAP
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgtatggctcggggggcgtctgggaggtccagggggggtccgggagcggcgtgcagggg
ctggggggcagctgggggcgcaggagacgcttcgactacatcggctccaacatggcagag
accctcagcctggccgaggggttggatggggacatcatgggacgctatgccgggctggcc
agggactgtggcgtgtggctgtccctgggtggcttccacgagcgcggccaggactggctg
accacgcagcgcatctacaactgccacgtgctgctggaccccacaggtcgccttgtggcc
gcttacaggaagacccacctgtgtgatgtggagctggagggacgtgtcaccatgaaggag
agcagcttcaccaaccctggcaccgagattgtggccccagtcagcacgccagcggggaag
ctcggcctctccatctgctacgacctgcgtttccctgagatctcgctggcgctgcggcgt
gccggtgccgagatcctcacctacccctcggccttcactgttcccacgggctcggcgcac
tgggaggtgctgctgcgggcccgggccatcgagagccagtgctacgtggtggcagccgcc
cagactgggaaaaaccacgagcgccggacatcctacggccacgcgctggtggtggacccc
tggggtgctgtggtggcccagtgccacgagggacccgggctctgctacgctgagatagac
ctcgactacctgcaccgcatccgccgggagatcccagtgcacggtcaccgccggcccgac
ctctacggcaccgtggcggccgcagggttggtgccggcaccatga

DBGET integrated database retrieval system