KEGG   Falco cherrug (Saker falcon): 102046431Help
Entry
102046431         CDS       T02911                                 

Definition
(RefSeq) beta-xylosidase/alpha-L-arabinofuranosidase 2-like
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00500  Starch and sucrose metabolism
fch01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102046431
Enzymes [BR:fch01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     102046431
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_3_C Glyco_hydro_3 Fn3-like
Motif
Other DBs
NCBI-GeneID: 102046431
NCBI-ProteinID: XP_027661862
Position
Unknown
AA seq 655 aa AA seqDB search
MTRHPPTPPCSPHSPELIYRVANATATEVRAKHNVFAATGRYGDHTGLSCFSPVLNIMRH
PLWGRNQETYGEDPFLSGELARSFVQGLQGQHPRYIKASAGCKHFSVHGGPENIPVSRLS
FDAKVLERDWRTTFLPQFQACVRAGSYSFMCSYNRINGIPACANKKLLTDILRGEWGFEG
YVVSDEGALELIMLGHHYTRTFLETAVASMNAGCNLELSYGMRNNVFMHIPQALAMGNIT
LQMLRDRVRPLFYTRMRLGEFDPPAMNPYSTLDLSVVQSPEHRNLSLEAAIKSFVLLKNV
RGTLPLRARDLPGKRLAVVGPFADNTRVLFGDYAPVPEPRYIYTPRRGLEMLPANVSFAA
GCREPQCQQYSQAEVVEVARAADMVVVCLGTGIDLETEAKDRRDLSLPGHQLELLQDIVQ
AAAGRPVILLLFNAGPLDVSWAQAHEGVGAILACFFPAQATGLAIARVLLGEAGATPAGR
LPATWPAGMHQVPPMENYTMEGRTYRYYGQEAPLYPFGYGLSYTTFRYQDLVLSPPVLPI
CANLTVSVVLGNVGQQDGEEGVQLYLRGEQSSVPVPRWQLVAFRRVAVLAGRGTKLSFQV
AAAQRAVWAQDWRLEPGTFTLFAGGQQPGQQTRVPSEVLSAQFTVTGAARPLRGC
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgacccgccaccccccaacacccccgtgctctccccacagccctgagctcatctaccgc
gtggccaacgccactgccactgaggtgagagccaagcacaatgtctttgctgccactggc
cgctacggtgaccacacagggctcagctgcttcagccccgtcctgaacatcatgaggcac
ccgctgtggggcaggaaccaggagacctacggggaggacccgttcctgagcggggagctg
gcccgcagctttgtgcaggggctgcagggccagcacccccgctacatcaaggccagtgcc
ggctgcaagcacttcagcgtgcacggtggccctgagaacatccccgtctccaggctcagc
ttcgatgccaaggtgctggagcgggactggcgcaccaccttcctgccccagttccaggcg
tgcgtgcgtgctggctcctacagcttcatgtgcagctacaacaggatcaatggcattccc
gcctgcgccaacaagaagctgctgacagatatcctacgtggcgagtgggggttcgagggc
tacgtggtgagcgacgagggggccctggagctcatcatgctggggcaccactacacgcgc
accttcctggagacggcagtcgcctcaatgaacgccggctgcaacctggagctctcttac
ggcatgaggaacaacgtcttcatgcacatcccccaggctctggccatgggcaacatcacg
ctgcagatgctgcgtgaccgggtccggcccctcttctacacacgtatgcggctgggggag
ttcgaccccccagccatgaacccctacagcaccctggacctgagcgttgtgcagagccct
gagcaccgcaacctctcgctggaagctgccatcaagagctttgtgctgctgaagaacgtg
cgggggacgctgcccctccgggcccgggatctgcccggcaagcgcctcgcggtggtgggt
cccttcgccgacaacacccgggtgctgttcggggactacgcaccggtgccggagccacgg
tacatctacactccccggagggggttagagatgctgccggccaacgtcagctttgcagcg
ggctgccgtgagccgcagtgccagcagtactcgcaggcagaggtggtggaggtggcaagg
gcagccgacatggtggtggtctgcttggggacagggatagatctggagacagaggcaaag
gaccggagggacctgtccctgccgggccaccagctggagctgctgcaggacatcgtgcag
gcagctgccgggcgccctgtcatcctgctgctgttcaacgcggggcccctggacgtgagc
tgggcgcaggcgcacgagggcgtgggggccatcctggcatgcttcttccccgcgcaggcc
accggcctagccattgccagggtcctgctgggtgaggcaggggccaccccggccggcagg
ctgccggccacgtggcccgcaggcatgcaccaggtgccacccatggagaactacaccatg
gaggggcggacgtaccggtactacgggcaggaggccccactctaccccttcgggtacggg
ctgtcctacaccaccttccgctaccaggacctggtgctgagtcccccagtgctgcccatc
tgtgccaatctcactgtgtctgtggtgctggggaatgtggggcagcaggatggcgaggag
ggggtgcagctgtacctgcggggggagcagtcatccgtgccggtgccccgctggcagctg
gtggctttccgccgtgtggctgtgctggctggccgggggaccaagctgtccttccaagtg
gcggccgcgcagcgtgccgtctgggcacaggactggcgccttgagcctggcaccttcacc
ctctttgctggtgggcagcagccgggccagcagacgcgggtgccttcggaggtgctgagc
gcacagttcactgtcaccggcgcagcccggcccctgcgcgggtgctaa

DBGET integrated database retrieval system