KEGG   Falco cherrug (Saker falcon): 102046673Help
Entry
102046673         CDS       T02911                                 

Gene name
PLK1
Definition
(RefSeq) serine/threonine-protein kinase PLK1
  KO
K06631  polo-like kinase 1 [EC:2.7.11.21]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04068  FoxO signaling pathway
fch04110  Cell cycle
fch04114  Oocyte meiosis
fch04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102046673 (PLK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102046673 (PLK1)
   04114 Oocyte meiosis
    102046673 (PLK1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102046673 (PLK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fch01001]
    102046673 (PLK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fch03036]
    102046673 (PLK1)
Enzymes [BR:fch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     102046673 (PLK1)
Protein kinases [BR:fch01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   102046673 (PLK1)
Chromosome and associated proteins [BR:fch03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     102046673 (PLK1)
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102046673 (PLK1)
  Sister chromatid separation proteins
   Polo kinases
    102046673 (PLK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase POLO_box Pkinase_Tyr Pkinase_fungal Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 102046673
NCBI-ProteinID: XP_027667504
Position
Unknown
AA seq 492 aa AA seqDB search
MDDWLHQENNGLSVGCWLCVAPQSLLELHKRRKALSEPEVRYYLRQTILGCQYLHSHRVI
HRDLKLGNLFLSDDMEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLGKKGHSFEVD
IWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNDYTIPKHINPVAANLIQKMLRSDPATR
PTIDELLSDEFFTSGYIPSRLPTSCLTIAPRFSIAPSGLELNGRKPLTALNKGPDSPAPE
NLPEKEDAARLREPGDAIDCHLADMLQQLTAVNSSKPSDRLAVRQEEAEDPACIPIFWVS
KWVDYSDKYGLGYQLCDNSVGVLFNDSTRLIMYNDGDSLQYIEQNSNESYFTVRSYPSAL
NKKITLLKYFRNYMSEHLLKAGANITPREGDELARLPYLCTWFRTRSAIILHLSNGTVQI
NFFQDHTKVILCPLMAAVTYIDEKRDFRTYKLSLIEEHGCCKELASRLRYARTMVEKLLS
SKSGSACVKSSA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggatgattggctccaccaggagaataatggtttaagtgttggctgctggctgtgtgtc
gccccgcagtcgctgctggagctgcacaagcggcggaaggcgctgagcgagcccgaggtg
cggtactacctgcgccagaccatcctgggctgccagtacctgcacagccaccgcgtcatc
caccgtgacctcaagctgggcaacctcttcctcagcgacgacatggaggtgaagatcggt
gactttggcctggccaccaaagtggagtacgatggcgagcgcaagaagaccctgtgtgga
acccccaactacattgctccagaggtcctgggcaagaaggggcacagctttgaggtggac
atctggtccattggctgcatcatgtacactctgctggttgggaaaccaccttttgaaact
tcttgtctaaaagaaacctacctccgaatcaagaagaatgactatactattcccaagcac
atcaaccccgtagctgctaacctcatccagaagatgctgaggtctgaccctgccacgcgc
ccaactattgacgagttgctgagtgacgagttcttcacatcgggatacatccccagccgc
ttgcccaccagctgcctcaccattgcacctagattttcaattgctcccagtggacttgaa
ctgaacgggcgaaagccgctgactgcacttaacaaaggaccagacagtcctgcaccagag
aacttgcctgaaaaagaagatgcagctagactgcgggagccgggagatgctattgactgt
cacttagctgacatgttgcagcaactgactgcggtcaactcatccaagccctctgataga
ctggcagtgagacaagaagaagctgaagacccagcctgcattcccatcttctgggttagc
aaatgggtggactactcggataaatatggtctaggctaccagctgtgtgacaacagtgtg
ggagttctcttcaatgactccactcgtcttattatgtacaatgatggtgacagcttgcag
tacattgagcaaaacagcaatgagtcctacttcactgtgagatcctacccctctgccttg
aacaagaagataacactattgaaatacttccggaactacatgagcgagcacttgctgaag
gcgggtgctaacatcacgccacgggaaggagacgagctggcccgtttaccctacctctgc
acttggttccggacccgcagcgccatcatcctgcacctcagcaatggcaccgtgcagatc
aacttcttccaggaccacacaaaggtcatcttgtgccctctcatggctgctgtcacatac
atagatgagaaacgggacttccgcacatacaagctgagcctcatcgaggaacacggatgc
tgcaaggagctggccagccggctccgctatgctcgcaccatggtggaaaagctcctcagt
tccaagtctgggtcagcctgtgtgaaatcctctgcttaa

DBGET integrated database retrieval system