KEGG   Falco cherrug (Saker falcon): 102047134Help
Entry
102047134         CDS       T02911                                 

Gene name
CHRNA4
Definition
(RefSeq) neuronal acetylcholine receptor subunit alpha-4
  KO
K04806  nicotinic acetylcholine receptor alpha-4
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102047134 (CHRNA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fch04040]
    102047134 (CHRNA4)
Ion channels [BR:fch04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   102047134 (CHRNA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_memb Neur_chan_LBD DUF2417
Motif
Other DBs
NCBI-GeneID: 102047134
NCBI-ProteinID: XP_005444933
Position
Unknown
AA seq 624 aa AA seqDB search
MGILVSKGNLLLLLCASIFPAFGHVETRAHAEERLLKKLFSGYNKWSRPVANISDVVLVR
FGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPQEYENVTSIRIPSELIWRPDIVL
YNNADGDFAVTHLTKAHLFYDGRIKWMPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYD
KAKIDLVSMHSHVDQLDYWESGEWVIINAVGNYNSKKYECCTEIYPDITYSFIIRRLPLF
YTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPL
IGEYLLFTMIFVTLSIIITVFVLNVHHRSPRTHTMPDWVRRIFLDIVPRLLFMKRPSAVK
DNCKKLIESMHKVTNTPRLWSEIDVEPNFATSSSSSPQSNEPSPTSSFCAHLEEPAKPQP
ICKSPSGQYSVLHPEPVQVTCSSPQASCRPLGDTQTTSILKGRSLSVQQMYSPNKAEEGS
IRCRSRSIQYCYLQEDSSQTNGQSTGSPASQRYHLNEEQPQHKPPQCKCKCKKNEAAGTP
AQGSKTHSAKEQHLVLMSPALKLAVEGVHYIADHLRAEDADFSVKEDWKYVAMVIDRIFL
WMFIIVCLLGTVGLFLPPWLAGMI
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgggaattctcgtgtctaaaggaaacctcctcctcctgctgtgtgccagcatcttcccc
gccttcggtcatgtggaaacacgagcccacgcggaagagcgtctcctgaagaaactcttc
tctggttataacaagtggtcccgtcccgtcgccaacatttcagatgtcgtactcgtccgc
ttcggcttgtccattgcccagctcatcgatgttgatgagaaaaatcaaatgatgaccacg
aacgtgtgggtgaaacaggagtggcatgactacaaactacgctgggacccccaagagtat
gaaaatgtcacatccatccgcatcccctcggagctcatctggaggccagatattgtcctc
tacaacaatgctgacggtgactttgcagttacccacctgaccaaggctcacctcttctat
gatgggagaattaaatggatgccacctgcaatctataaaagctcctgcagcatcgatgtt
accttcttcccctttgaccaacaaaactgcacaatgaagtttggctcctggacctatgat
aaagccaagatagacttggtgagcatgcacagtcatgtggaccagctggactactgggag
agcggggaatgggtcatcatcaatgctgtgggcaattacaacagcaagaaatatgaatgc
tgcacagagatctaccccgatataacttactccttcattatccggaggctgccactgttc
tacacaatcaatctgatcatcccttgcctgctgatctcctgcctgactgtcctggtcttc
tacctgccctctgagtgtggagagaagataaccttgtgcatctccgtgctgctgtccctc
actgtgttcctgctgctcatcacagagatcatcccatctacctccttggtcatccctctg
attggagagtatcttctcttcaccatgatatttgttaccttgtctatcattatcactgtc
tttgtcctcaatgtgcaccatcgttctccacgtacccacacgatgcctgactgggtgaga
aggatcttccttgacatagtcccacgcctcctcttcatgaaacgtccctccgcagtgaaa
gacaattgcaagaagctcattgaatccatgcacaaagtaaccaatacgccaaggctttgg
tccgagattgatgtggaacccaacttcgctacctcatcttcctccagcccccagagtaat
gagccatcacccacgtcttccttctgtgcccacctcgaggagccagccaagcctcagcct
atctgcaagtccccttctgggcagtactctgtgctgcacccagagcccgtgcaggtgacc
tgctcctctccacaagcctcatgccgccctctgggtgacacccagaccacctccatcttg
aaaggcagatcactaagtgtgcagcagatgtacagccccaataaggcagaggaagggagc
atccgctgtaggtcccggagcatccagtattgctacctgcaagaggactcttcccagacc
aacggccaatccactggttctccagcatcccagcggtaccacctaaatgaagagcagccc
cagcacaagccccctcagtgcaagtgtaaatgcaaaaagaatgaggcagctggcacacca
gcccaaggaagcaagactcacagcgccaaagagcaacaccttgtgttgatgtccccagcc
ctgaagttggcagtggaaggggttcattacatcgcagaccacctgcgagcagaagacgcg
gatttctcagtgaaagaagactggaagtacgttgcgatggtcattgacaggatcttcctc
tggatgttcatcattgtgtgtttgctgggaactgttggtctcttcctcccaccgtggctg
gctggaatgatctaa

DBGET integrated database retrieval system