KEGG   Falco cherrug (Saker falcon): 102047196Help
Entry
102047196         CDS       T02911                                 

Gene name
CACNG3
Definition
(RefSeq) voltage-dependent calcium channel gamma-3 subunit
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04010  MAPK signaling pathway
fch04260  Cardiac muscle contraction
fch04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102047196 (CACNG3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102047196 (CACNG3)
   04261 Adrenergic signaling in cardiomyocytes
    102047196 (CACNG3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fch04040]
    102047196 (CACNG3)
Ion channels [BR:fch04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102047196 (CACNG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 102047196
NCBI-ProteinID: XP_027667507
Position
Unknown
AA seq 295 aa AA seqDB search
MPLTVGASKPQRPSCSLHIGKFSHIQQRSCQRGGFFLLQRSQGFLACVSPGTFRGVCKKI
DHFPEDADYEQDTAEYLLRAVRASSIFPILSVGLLFFGGLCVAASEFYKSKHNVILSAGI
FFVSAGLSNIIGIIVYISANAGDPGQSDSKKSYSYGWSFYFGALSFIIAEMVGVIAVHMY
IEKHRQIRAKSHSELLKKSAFTRLPPYRYRFRRRSSSRSTEPRSRDMSPVSKGFSAIPST
DISMFTLSRDPSKVTMGTLLNSERDHGFLQVHNSIPKEFKESLHNNPANRRTTPV
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgacggtgggggcaagcaagccgcagcggccgagctgctccctccacattgga
aagttctcgcacatccagcagcgctcctgccagcgtggaggtttcttccttctgcagagg
tctcaaggtttcctggcttgtgtctccccaggaacgttccgaggagtgtgcaagaaaatc
gaccacttccctgaggatgcagattacgagcaagacacggccgagtatctcctccgtgcg
gtgagagcatccagcatcttccccatcctcagcgtgggtctgctgttcttcgggggcctg
tgcgtggcagccagcgagttctacaagagcaaacacaacgtcatcctcagcgccggcatc
ttcttcgtctctgcaggtctcagcaacatcatcgggattatagtctacatctcggccaac
gcaggggacccagggcagagcgattccaagaagagctactcctacggctggtccttctac
ttcggagccctgtccttcatcatcgccgagatggtgggggtgatcgccgtgcacatgtac
atcgagaagcaccgccagatccgtgccaagtcccactcggagctgctgaagaagtcggcc
ttcacccgcttacccccctacaggtaccgcttccgccggcggtcgagctcccgctccacc
gagccccggtcccgggacatgtcgcccgtcagcaaggggttcagcgccatcccctccacc
gacatctccatgttcaccctctccagggatccctccaaggtcaccatggggacactgctc
aactcggagcgggaccacggttttttacaggtccataactccatccccaaagagttcaag
gagtctttgcacaacaacccggccaacagacgaaccacgccagtctga

DBGET integrated database retrieval system