KEGG   Falco cherrug (Saker falcon): 102047581Help
Entry
102047581         CDS       T02911                                 

Gene name
ABHD12
Definition
(RefSeq) abhydrolase domain containing 12
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
fch  Falco cherrug (Saker falcon)
Brite
KEGG Orthology (KO) [BR:fch00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fch01002]
    102047581 (ABHD12)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fch04147]
    102047581 (ABHD12)
Enzymes [BR:fch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102047581 (ABHD12)
Peptidases [BR:fch01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   102047581 (ABHD12)
Exosome [BR:fch04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   102047581 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Thioesterase Peptidase_S9 Peptidase_S15 Abhydrolase_2 Say1_Mug180
Motif
Other DBs
NCBI-GeneID: 102047581
NCBI-ProteinID: XP_014136484
Position
Un
AA seq 363 aa AA seqDB search
MEAGFDRQEDSPFPVTALEIMPKTYPGLKRYGLWFRLRKLIIWLLGVYIAIPFLVKLCPA
IQAKLVFLNFVRVPYFIDLKRPQDQGLNHTCNYYLQPEEDVTIGVWHTVPAALWKNARGK
DQLWFEDALGSSHPVILYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGDSIGSP
SERGMTYDALHVFDWIKARSGDNPVYVWGHSLGTGVATNLVRRLCERETPPDALILESPF
TNIREEARSHPFSVIYRYFPGFDWFFLDPITTSGIKFANDENVKYISCSLLILHAEDDPV
VPFQLGKKLYNIAATSRSFRDYKVQFVPFHTDLGYRHKYIYRSPELPRILREFLGKSEHE
HHH
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggaggcaggttttgacagacaagaggatagcccattccctgtgactgctctagaaatc
atgccaaaaacttacccaggtttaaagcgatatggattatggtttcggttgcggaagtta
ataatctggttgctgggagtgtacatagccattccatttctagtaaaactttgccctgct
attcaggcaaagctggtcttcctaaactttgtgagggtcccatatttcattgacttgaaa
agaccacaggatcaaggtttaaaccacacctgtaattattatctgcagccagaggaggat
gtaaccattggagtgtggcatacggtccctgcagccttatggaagaatgcccgagggaag
gaccagttgtggtttgaagatgctttgggttccagccatcctgtaatcctttacttgcac
ggcaatgcgggaacaagaggaggggatcatcgcgtggagctttacaaggttctcagctcc
ctcgggtaccatgtggtcacgtttgattatcgaggctggggtgattcgataggcagcccg
tcagagaggggaatgacctacgacgcccttcatgtctttgactggataaaagcaagaagt
ggagacaaccctgtctatgtatggggacactccttgggcacaggggttgcaacaaatctt
gtgaggcgcctttgtgagagagaaacgcccccggatgccctgatcctggaatctccattc
acgaacatacgggaggaggcgcgaagtcaccccttttctgtgatatacagatacttccct
ggctttgactggttcttccttgaccccatcacgacaagtggaattaaatttgcaaatgat
gagaatgtgaaatacatttcatgctccctactcatccttcatgctgaggatgacccagtg
gtaccatttcagctgggaaagaagctttacaacattgctgcaacgtcacggagtttccga
gactacaaggtgcagtttgttccattccacacagaccttggctaccggcacaagtacatc
tacaggagtccagagctacctcgaatactgcgggaattcctcggaaaatctgaacatgag
catcatcactga

DBGET integrated database retrieval system