KEGG   Falco cherrug (Saker falcon): 102047749Help
Entry
102047749         CDS       T02911                                 

Gene name
ATG16L1
Definition
(RefSeq) autophagy-related protein 16-1 isoform X4
  KO
K17890  autophagy-related protein 16-1
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04136  Autophagy - other
fch04140  Autophagy - animal
fch04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:fch00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102047749 (ATG16L1)
   04136 Autophagy - other
    102047749 (ATG16L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102047749 (ATG16L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fch04131]
    102047749 (ATG16L1)
   03029 Mitochondrial biogenesis [BR:fch03029]
    102047749 (ATG16L1)
Membrane trafficking [BR:fch04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    102047749 (ATG16L1)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    102047749 (ATG16L1)
Mitochondrial biogenesis [BR:fch03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    102047749 (ATG16L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A Ge1_WD40 ERM Fez1 KASH_CCD V_ATPase_I SGL HTH_6 Lipoprotein_6 WD40_like YabA YicC_N
Motif
Other DBs
NCBI-GeneID: 102047749
NCBI-ProteinID: XP_005441747
Position
Unknown
AA seq 545 aa AA seqDB search
MQSRHEISPGHDGTWNDAQLQELAQLKIKHQEELTELHKKRGELAQSVIDLNNQMQQKDK
EMQMNEAKIAEYLQKISELETECQELRSKLQDLERANQTLKDEYDALQITFNALEEKLRK
TTEDNQELVSRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEPDDDIEV
LADETSDTAEETSPVRAVSRTSSKRLSQPAGGLLDSITNIFGRRSLSSFPAPQDNVEPHP
GASKEVRVPTTAICVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVLGDRCEPKGSL
SGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDNRLRHTLTGHSGKVLSAKFLLDNAR
IVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRTESVV
KELELLGRITALDLNSERTELLTCSRDDLLKIIDLRVSAVKQTFSAQGFKCGSDWTRVVF
SPDGNYVAAGSADGALYIWNVLTGKLERTLAKHHSSPINAVAWSPAGAHVVSVDKGNKAV
LWSEF
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcagacatgaaatcagtccaggacatgatggcacatggaatgatgctcagttg
caggaattggcacagctgaagataaagcatcaagaggagctgacagagctgcataagaaa
cgtggcgagctggcccagtctgtaattgatctgaataaccaaatgcagcagaaggacaaa
gagatgcagatgaatgaagcgaagattgcagagtatttgcaaaagatctctgaactggaa
acggagtgccaggaattgcgtagcaaactgcaagatcttgagcgagctaatcagacactg
aaagatgagtacgatgctctccagatcaccttcaatgccttggaggagaaactaaggaaa
actactgaagacaaccaggagctggtctcacgttggatggcagagaaagcacaagaagcc
aatcgtttgaatgcagagaatgaaaaggattcaaggagacgacaggccaggctgcagaag
gagctagcagaagctgccaaagaacccctgcctgttgaaccggatgatgatattgaagtg
cttgcagatgaaacctctgacacagctgaggagacatcaccagtgcgagctgtcagccga
acgtccagtaagcgactctcccagccagctggaggccttctggactctatcactaatatc
tttgggagacgttctttgtcctcgttccctgctccccaggataatgtagagccacatcca
ggtgccagtaaagaagtgagagtgcccactactgccatatgtgtctttgatgcacatgat
ggggaggtgaatgcagtgcagttcagccctggctcccggttactagcaacaggaggcatg
gaccggagggttaagctttgggaagtcttgggagataggtgtgagcccaaaggttccctc
tctggtagtaatgctgggattaccagcatagaatttgatagtgctggttcatacctctta
gcagcttcaaatgactttgccagcagaatctggacagttgatgacaatcggttacggcac
accctgacaggtcacagcggtaaagttctgtcggccaagttcttgctggacaatgcacgc
attgtttcgggaagtcatgaccggaccctcaagctgtgggacctccgcagcaaagtttgt
ataaaaacagtgtttgcaggatctagctgcaatgacatcgtatgtactgagcaatgtgta
atgagcggacatttcgataagaaaattcgtttctgggacatcaggactgaaagcgtagta
aaagaactggagctgcttggaagaattacagctctggacctgaactcggagcgaacggag
cttttgacctgttcccgtgatgatctactgaagatcatcgatctgcgggttagtgctgtc
aagcagacgttcagtgcccagggattcaaatgtggctctgactggacaagagttgtgttc
agccctgatggtaactatgtggctgctggttcagctgatggggccctttacatctggaat
gtgctcactgggaaattggagaggacgcttgcaaagcaccacagttctcctatcaatgca
gtcgcatggtcaccagcgggtgcccacgtggtcagtgtggacaaaggcaacaaggctgtc
ctgtggtctgagttctga

DBGET integrated database retrieval system