KEGG   Falco cherrug (Saker falcon): 102047953
Entry
102047953         CDS       T02911                                 

Gene name
ASIC1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X2
  KO
K04829  acid-sensing ion channel 1
Organism
fch  Falco cherrug (Saker falcon)
Brite
KEGG Orthology (KO) [BR:fch00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fch04040]
    102047953 (ASIC1)
Ion channels [BR:fch04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   102047953 (ASIC1)
SSDB
Motif
Pfam: ASC DUF4074
Other DBs
NCBI-GeneID: 102047953
NCBI-ProteinID: XP_005436026
Position
Unknown
AA seq 527 aa
MMDLKVDEEEVDSGQPVSIQAFASSSTLHGLSHIFSYERLSLKRVVWALCFLGSLALLAL
VCTNRIQYYFLYPHVTKLDEVAATKLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLN
NRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEKC
TPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDET
SFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKAVAGDSEF
YDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYC
VCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIE
QKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHRLCRRGKCHKNHKRNNTD
KGVALSMDDVKRHNPCESIRGHPAGMTYAANILPHHPARGTFEDFTC
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgatggacctgaaagtggacgaggaggaggtggacagcgggcagccggtgagcatccag
gccttcgccagcagctccaccctccacgggctctcgcacatcttctcgtacgagcggctg
tcgctgaagcgcgtggtctgggcgctgtgcttcctgggctcgctggcgctgctcgccctc
gtctgcaccaaccgcatccagtactacttcctctacccccacgtcaccaaactggacgag
gtggcggccaccaagctcaccttccccgccgtcaccttctgcaacctcaacgagtttcgt
ttcagccgggtgaccaagaacgacctgtaccacgccggcgagctcctcgccctgctcaat
aacagatacgagatcccagatacccagaccgccgatgagaagcagctggaaatcctgcag
gataaggcgaactttcgaaatttcaaacccaaacctttcaatatgctggaattttatgac
cgggctggccacgatatccgggagatgctgctgtcctgcttcttccgcggggagaaatgc
acccccgaagacttcaaagtggtcttcacccgctacgggaagtgctacaccttcaacgcg
gggcaggacgggaagccccggctcatcaccatgaaggggggcaccggcaacggcctggag
atcatgctggacatccagcaggacgagtacctccccgtgtggggggaaacagacgaaacc
tcgttcgaagctgggatcaaggtgcagatccacagccaggatgagcccccgctgatcgac
cagctgggcttcggggtggctcccggcttccagaccttcgtgtcctgccaggagcagcgg
ctcatctacctgccgcctccctggggtgactgcaaggccgtggcgggcgactcggagttc
tacgacacttacagcatcaccgcctgccgcatcgactgcgagacccgctacctggtggag
aactgcaactgccgcatggtgcacatgccaggtgatgccccttactgcaccccggagcag
tacaaggagtgcgcagatccagccttagatttcctggtggagaaggacaacgagtactgc
gtctgcgagatgccctgcaacgtgacccgctacggcaaagagctctccatggtgaagatc
cccagcaaagcctccgccaagtacctggccaaaaagtacaacaagtcggagcagtacatc
ggggagaacatcctggtgctggatatcttcttcgaagccctgaactacgagacgatcgag
cagaagaaggcgtacgaggtagccggtttgctgggtgacatcggggggcagatggggctg
ttcatcggggccagtatcctcacggtgctggagctgtttgactacgcctatgaggtgatt
aagcaccggctgtgccggcggggcaagtgccacaagaaccacaagcggaacaacacggac
aagggcgtcgcgctgagcatggacgacgtgaaacgccacaatccctgcgaaagcatacgg
ggccacccggccggcatgacgtacgcagccaacatcctacctcaccacccggcccggggc
accttcgaggacttcacctgctaa

DBGET integrated database retrieval system