KEGG   Falco cherrug (Saker falcon): 102048758
Entry
102048758         CDS       T02911                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
fch  Falco cherrug (Saker falcon)
Brite
KEGG Orthology (KO) [BR:fch00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fch01002]
    102048758
Enzymes [BR:fch01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     102048758
Peptidases and inhibitors [BR:fch01002]
 Metallo peptidases
  Family M1
   102048758
SSDB
Motif
Pfam: ERAP1_C Peptidase_M1
Other DBs
NCBI-GeneID: 102048758
NCBI-ProteinID: XP_027656095
Position
Unknown
AA seq 631 aa
MKALSERTTSKFADDTKWGEAADMACRIRLQGLIRLINIVSYRLEYSNLCDKLCIQIQKL
FSLFYAQWFGNLVTMEWWDDLNLNEGFATFMVYVSVNVTHPELSAENCFLRRCFXMAVNA
LNSSHPVSTPVEDPAQILEMFDSVSCQKGSCILNMLKHYLTDVFKAEVVQYLXNEDLWNS
TTTANLPYGTDKNELKGDGFCRGSQKSSSNAHWTEQETLDVRALMDTWMQKGSPLVTDPV
RGKNVHLQQECYMKGADSSSSTGYLRHIPLTYITGKSDTVQRFLMTTKADDIILPEEVEW
IKFNVDMNEFYIVHYKDDGWGHLTNLLKENHTLVSSNDRASLINNVFQLVEXKTPSICKA
LDLTLXLKCEREILPVLQGMNEMILTYRLVKWRDMDGTEKQLKGYIISLFKDPIDGQSWS
DEGSVSEQLLRNLLLLFAXVHRYQLCLDKVKEYCTEWQKSNGTLSLPADVKAAVYAVGXQ
TSNGXDFILRKYRLNLFSVEGENTELALSLGGIKDKLQWLMDQGLHGDTRTQDLPHIRTS
XLGTFLKENWEKFKKRKFELSLNSVASTVTGMTSWYLTRSQLAQVKEFFSSLEEKSAWLC
CVQQXETIEDNRQWTDRKFETVKTWWQNNHL
NT seq 1896 nt   +upstreamnt  +downstreamnt
atgaaggcactgagcgagcgcaccaccagcaagtttgctgatgatacaaaatggggagaa
gcggccgacatggcatgcagaatcagactccagggtcttatccgattaataaatatagtt
tcatacaggttagaatacagcaacctttgtgataaattgtgtattcaaattcagaaatta
ttctctcttttttacgcccagtggtttggcaaccttgttactatggagtggtgggatgat
ctgaacttaaatgaagggtttgcgacctttatggtgtatgtgtcagtcaatgttacccat
ccagaactgagtgctgaaaactgtttcttaaggagatgttttnnaatggcagtgaatgca
ttaaattcatcacatcctgtatctactcctgtggaagatccagctcaaattttagaaatg
tttgatagtgtttcttgtcagaagggatcctgtatattaaatatgctgaagcactacctg
actgatgtgtttaaagctgaagtcgtgcagtatttgncaaatgaagatttgtggaacagc
acgacaactgcaaatttgccctacggtactgacaagaatgaactaaaaggggatgggttt
tgcagaggaagccaaaaatcatcttcaaatgcacactggactgaacaagagactcttgat
gtgagggcactgatggacacttggatgcaaaaaggttctcccctggtaactgatccagtg
agagggaagaacgtccacctgcagcaggaatgctacatgaagggagcagattcttcttca
tccacagggtacttgaggcacattcccctaacctacattaccggtaaatctgacactgtt
cagagatttttgatgacaactaaagcagatgacattatccttccagaagaggtggagtgg
attaaattcaacgtggacatgaatgagttttacattgtgcactacaaagatgatggatgg
ggtcatctgactaatcttttgaaagagaaccatacactggtcagcagcaatgacagagca
agtctcattaacaacgtattccagcttgtagaataaaaaaccccgtcaatttgcaaagct
ttagatttaactttgtaactgaaatgtgaaagagaaatcttgcctgtactccaaggtatg
aatgagatgatacttacatacaggcttgtgaagtggagggatatggatggtacagagaaa
cagttaaaggggtatataatcagcctatttaaagacccgattgacgggcagtcttggagt
gatgaaggctcagtgtctgagcaattgcttaggaacttgctcctactgtttgcatgagtg
cacaggtaccagctatgcctagacaaagtgaaagaatattgcaccgaatggcagaaatcc
aatggaacattgagcttgccagcagacgtgaaagcagcagtgtatgctgttgganngcag
acatccaatggctaggatttcatcctccgtaaatacagactgaacttgttcagtgtagag
ggagagaacactgaattagctcttagcctcggtggaattaaggacaaactgcagtggtta
atggatcaaggtctgcatggtgacacaagaactcaggatcttccgcatattagaacatct
nagcttgggacatttttaaaagaaaattgggagaaatttaagaaacgcaagtttgaactc
agtttgaattccgtagcaagcactgtcactggcatgacaagttggtacttaacgaggtca
cagcttgcacaggtgaaagaattcttcagttctctggaggaaaaaagtgcatggctttgc
tgtgtccagcaanntgaaaccattgaagacaacagacaatggacggatcgaaaatttgag
actgtcaaaacatggtggcaaaacaaccacctgtaa

DBGET integrated database retrieval system