KEGG   Falco cherrug (Saker falcon): 102049244Help
Entry
102049244         CDS       T02911                                 

Gene name
QDPR
Definition
(RefSeq) dihydropteridine reductase
  KO
K00357  dihydropteridine reductase [EC:1.5.1.34]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00790  Folate biosynthesis
fch01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fch00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    102049244 (QDPR)
Enzymes [BR:fch01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     102049244 (QDPR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short ALF
Motif
Other DBs
NCBI-GeneID: 102049244
NCBI-ProteinID: XP_027663982
Position
Unknown
AA seq 191 aa AA seqDB search
MGSLENVLVFTKVTTEVGKLLGEEKVDAILCVAGGWAGGSAKAKSLYNNCDLMWKQSVWT
STISSHLATKHLKEGGLLTLTGAQAALSGTPGMIGYGMAKGAVHQLCQSLAGANSGLPSG
SAAVAILPVTLDTPANRKSMPGADFSSWTSLEFIAETFYNWITGKNRPNSGSLIQVITTG
GKTELVAAAHL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgggatccctagagaatgtgctggttttcacgaaggtgacaacagaggttggaaaactt
cttggtgaagaaaaggtggatgcgatcttgtgtgtagctggaggatgggctggaggcagc
gccaaagctaagtctttatacaataactgtgatctgatgtggaagcagagtgtttggacg
tcaactatttccagccacctagccacaaaacacctgaaagaaggcggcctgttgactttg
acaggagctcaggctgctttatctggaaccccagggatgattggctacggcatggccaaa
ggagcagtgcatcagctttgtcagagtttagctggtgccaatagtggcttgccatctggg
tctgctgctgttgccattttaccggttaccttagatacaccagcaaacaggaaatcaatg
cctggtgcagatttcagctcctggacatccttagaattcattgctgaaaccttttacaac
tggataacagggaagaatcgaccaaactcggggagtcttatccaggtgataactacagga
gggaagactgaactcgttgcagcagcacatctttga

DBGET integrated database retrieval system