KEGG   Falco cherrug (Saker falcon): 102049681Help
Entry
102049681         CDS       T02911                                 

Gene name
SUCLG2
Definition
(RefSeq) succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00020  Citrate cycle (TCA cycle)
fch00640  Propanoate metabolism
fch01100  Metabolic pathways
fch01200  Carbon metabolism
Module
fch_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fch_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102049681 (SUCLG2)
   00640 Propanoate metabolism
    102049681 (SUCLG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fch04147]
    102049681 (SUCLG2)
Enzymes [BR:fch01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     102049681 (SUCLG2)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     102049681 (SUCLG2)
Exosome [BR:fch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102049681 (SUCLG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 DUF3141
Motif
Other DBs
NCBI-GeneID: 102049681
NCBI-ProteinID: XP_014135661
Position
Unknown
AA seq 384 aa AA seqDB search
MADHGVTVQRFFVADSANDALQAAQRLKAKEIVLKAQILAGGRGKGIFNSGLKGGVHLTK
DPEIVEQLAKQMIGYNLSTKQTPKDGVTVKKVMVAEALNISRETYFAILMDRACNGPVMV
GSPQGGVDIEEVAVTSPELIFKEEIDIFEGIKDHQALQMAKNLGFKGPLEQQAADQIKKL
YNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKEIFAMDDKSENEPIENE
AAKYDLKYIGLDGNIACFVNGAGLAMATCDIISLNGGKPANFLDLGGGVKEAQVYQAFKL
LTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVHEAQRILNES
GLPITSANNLEDAAKKAVASVAKK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggcagaccatggggttacagttcagagattcttcgtggccgattctgcaaatgatgcc
ctgcaggctgctcagagactaaaggcaaaggaaattgttctgaaggcacagattctggct
ggagggagaggaaaaggtattttcaatagtggattaaaaggaggagttcatctaactaaa
gaccccgagattgttgaacagcttgctaaacagatgattgggtacaatctgtcaacaaag
caaactccaaaggatggtgtgacagttaaaaaggtgatggttgcagaagcactgaatatt
tccagggaaacatacttcgcaattttgatggacagagcctgcaatggacctgttatggtt
ggcagtccacagggtggtgttgacatagaagaagttgcagttactagcccagaacttatc
tttaaggaggaaatagatatttttgaaggtataaaggatcatcaggcattgcagatggca
aaaaatttgggattcaaaggacctttggaacagcaggcagcagatcaaattaagaagctg
tataatcttttcttgaaaattgatgccactcaggttgaagtgaatccctttggtgaaact
ccagaagggcaagttgtttgttttgatgccaagataaactttgatgacaatgcagaattt
aggcaaaaagaaatatttgccatggatgacaagtctgaaaatgagcctatagagaatgaa
gctgccaaatatgacttaaaatatataggactggatggaaatattgcttgctttgtcaat
ggagctggacttgcaatggcaacatgtgatataatatccttgaatggtggaaagccagcc
aacttcttggatcttggtggaggtgtgaaagaagcacaagtatatcaagcattcaagctg
ctgactgctgatccgaaggttgaagcaatacttgtgaacatatttggtgggatcgtgaac
tgtgccattatagccaatggtattaccaaagcctgccgagagcttgagctgaaagtacct
ctggtggtcaggctggaaggaacaaatgttcatgaagcccagcgtattctgaatgaaagt
ggactccccatcacgtctgcaaataaccttgaggatgcagcaaagaaggcagtggctagt
gtggcaaaaaaataa

DBGET integrated database retrieval system