KEGG   Falco cherrug (Saker falcon): 102050252
Entry
102050252         CDS       T02911                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor isoform X1
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
fch  Falco cherrug (Saker falcon)
Brite
KEGG Orthology (KO) [BR:fch00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fch03000]
    102050252 (AHRR)
Transcription factors [BR:fch03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102050252 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_11 PAS_9 PAS_4
Other DBs
NCBI-GeneID: 102050252
NCBI-ProteinID: XP_005432028
Position
Unknown
AA seq 777 aa
MIPPGECLYAGRKRRKPIQKQRPAVGNEKSNPSKRHRDRLNAELDHLASLLPFPPDIISK
LDKLSILRLSVSYLRVKSFFQAIQEKHFKKQVGQMIKEDNISNKTAVQEGGLLLESLNGF
ALVVSADGMIFYASSTIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMNPPQMLS
GQQLQTETGEEYILSKLFKAQENDSMTTDYSPFLTRCFICRVRCLLDSTSGFLTMQFQGK
LKFLFGQRKKSSSGTVLPPQLSLFCIVVPLLLPSVTEMKMKSLLVKAKHKADDAAAVNTN
SSAKGNSGLCEAAEMYGRNSHHEGAAFTNVLQIAENQIKAKNNGENGISLVKVQTNEDHW
VWVQANTQLLYRNGCSEYVLAQQQMLKEEDEQLKILSGFASLKGNLEGLPYNSAIETLGQ
WKHLNWTAVKNEQDNVKVKFEPHTNSECFMQEEPLSSNTSVSGVQNNCTTNSSWTLRNSS
SCSMSQRMSTCSNRRAGSFYNRDQSFLNLASTCPSHWGSTENCQSYSSVQQRCVENYATD
HPKSQRPLISSESAYDAAFPLEMPIKTEYDSDSENIAHNYLMSQNRAWLDENGSVRKQVF
SYPSRVHLKTEPDLCEPASPCQKPRHCLYTPHNWQCIVANHPSNLNQNRSCKGSHSKEVA
PFCPQNSSACSESMPSLPHTACYGHFYSPSPGEEKEHNNEVFKMPCEFKMPCLVQAIKRE
PRDSPPLSNSGQNRVHTSFPENTLAGLDSLSHPSERDYLDLVSHYLASSLITYIDAT
NT seq 2334 nt   +upstreamnt  +downstreamnt
atgattcctccaggggaatgcctatatgctgggaggaaaaggaggaaacccattcagaaa
caaaggcctgcagttgggaatgaaaaatcaaatccttcgaagagacacagggaccgtctg
aacgcggagctggaccacctggccagcctcctgccttttccacctgacatcatatcgaag
ttggacaaactttccatcttgcgccttagtgtcagctatctcagagtcaaaagtttcttc
caagccattcaagaaaagcactttaagaagcaagttggccaaatgataaaagaagacaat
atatctaacaagaccgctgtacaagaaggtggacttctactagaatcactgaacggtttt
gcattggtggtgagtgcagatggaatgatattttatgcatcatcgacgattgtggactat
ctagggtttcatcagactgatgtaatgcaccaaaacatatatgattacattcacgtggat
gatcgccaggatttctgtagacaactgcactgggccatgaatcctccccagatgttgtct
ggacagcaactacagacagaaacaggagaagaatatattctcagtaaattgtttaaagca
caggagaacgacagcatgacaacagattattctcccttcttaactcgctgtttcatctgt
cgagttcgctgcttgttggacagtacttctggcttccttacaatgcagttccaaggcaaa
ctaaagtttctttttggacaaaggaagaaatcctcatcaggaacagtactgccacctcag
ctgtccttattctgtatagtggtaccacttctgctcccttctgtgacagagatgaagatg
aaaagtctgcttgtgaaagcaaaacacaaagctgatgatgcagcagctgtgaatacaaac
tccagtgccaaaggtaattcagggctgtgtgaagcagcagaaatgtatggaagaaacagt
catcatgaaggtgccgctttcactaatgtgttacagattgctgagaaccaaatcaaagca
aagaataatggagaaaatggcatttcactagtcaaagtacaaacaaatgaagatcactgg
gtctgggttcaagctaacactcaacttctgtatcgaaatggttgttcagaatatgtcctt
gcccaacagcaaatgttaaaggaagaagatgaacaactgaagatactaagcggttttgcc
agtttgaaagggaacctggaaggacttccctataacagtgccattgaaactctgggccag
tggaaacaccttaactggacagcagtaaaaaacgaacaagataatgtaaaagtgaagttt
gagcctcatacaaacagtgagtgttttatgcaagaggaacctctcagttccaacacatca
gtttcaggtgttcaaaacaactgcaccacaaacagtagctggactttaagaaactcaagc
tcttgttctatgagccagcgaatgagcacgtgttcaaacaggagagctggatcattctac
aacagagaccaaagtttcttaaatttagcatcaacttgcccttcccactgggggagcaca
gaaaactgccagtcttactcgagtgtgcaacagcgttgtgtggagaactatgcaacggac
catccgaaatcgcagagaccattgatatcctcagagtctgcctatgacgcagcctttccc
ttagagatgcctatcaaaacagaatacgattctgactcggaaaacattgcccataactac
ctgatgtcgcaaaaccgagcctggctggatgagaatggctcggtgagaaagcaggtgttt
agctaccccagtagagtgcacctcaaaacagaaccggacctctgtgagccagcctcacct
tgtcagaagccaaggcactgcctctacacgccacataactggcaatgcatcgtagcaaat
caccccagcaacctaaaccagaacagatcttgcaagggttcacatagcaaggaggtggcc
ccgttttgccctcagaactcatctgcgtgttcggaaagcatgcccagcctgccgcacaca
gcatgctacggccacttctacagccccagcccaggggaggagaaagagcacaataatgaa
gtgttcaaaatgccgtgtgaatttaaaatgccctgcttggttcaagcaatcaagcgtgag
ccccgggattctccaccgttgtccaacagtggacagaacagagtacacacgagcttccct
gaaaatacattagcaggcttggactcactgtcacacccttctgaacgggactacctggac
ctggtttcacactaccttgcatcttctctcatcacttacattgatgcaacatga

DBGET integrated database retrieval system