KEGG   Falco cherrug (Saker falcon): 102050541Help
Entry
102050541         CDS       T02911                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00010  Glycolysis / Gluconeogenesis
fch00562  Inositol phosphate metabolism
fch01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102050541 (MINPP1)
   00562 Inositol phosphate metabolism
    102050541 (MINPP1)
Enzymes [BR:fch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     102050541 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     102050541 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708
Motif
Other DBs
NCBI-GeneID: 102050541
NCBI-ProteinID: XP_005446315
Position
Unknown
AA seq 263 aa AA seqDB search
MRFFDHCAKFVALVEENDTAMCQVNAFKEGPEMRKVLEKVASALCLPVEDINADLVQVAF
LTCSYELAIKNVTSPWCSLFSEEDAKVLEYLNDLKQYWKRGYGYDINSRSSCILFQDIFQ
HLDKAVEESKSSKPISSPLIIQVGHAETLQPLLALMGFFKDDEPLKANNYIRQTHRKFRS
GRIVPYAANLVFVLYHCDQVKTSKEEFQVQMLLNEKPMLFHHSNETTSTYADLKDYYKDI
LENCHFKEECELPKVNITAIDEL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttttttgatcactgcgccaagtttgtagccttggtggaggagaacgacacggcg
atgtgccaggtgaatgccttcaaagaggggccagagatgaggaaggtcttggagaaggtc
gcgagtgccttgtgtttgccggtggaggacataaacgcagatcttgttcaagtggctttt
ctcacctgctcatatgagttggctataaaaaatgtgacctccccatggtgttcactcttc
agtgaagaagatgccaaggtactggaatacctgaatgatctgaagcaatactggaagagg
ggatatggctatgacatcaatagtcgctctagctgcattttattccaagatatcttccag
catttggacaaagcggtggaagagagcaaaagttcaaaacccatttcttcacctctgatt
atacaagttggacatgcagagacacttcagccattgcttgcccttatgggtttcttcaaa
gatgatgaacccctcaaggcaaacaattacatcagacaaacgcatcggaaatttcgcagt
ggccggattgtgccttatgcagccaacctggtatttgtgctttaccactgtgatcaagtg
aaaacctctaaagaagaattccaagtgcagatgctgttgaatgaaaaaccgatgttgttt
catcactcaaacgaaaccacctctacttatgcagacctcaaggactattacaaggacatc
ctggaaaactgccacttcaaagaagagtgcgaattaccaaaagttaatattactgctatt
gacgagctttga

DBGET integrated database retrieval system