KEGG   Falco cherrug (Saker falcon): 102053935Help
Entry
102053935         CDS       T02911                                 

Gene name
GPX3
Definition
(RefSeq) glutathione peroxidase 3
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00480  Glutathione metabolism
fch00590  Arachidonic acid metabolism
fch01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fch00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102053935 (GPX3)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102053935 (GPX3)
Enzymes [BR:fch01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     102053935 (GPX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx SUIM_assoc
Motif
Other DBs
NCBI-GeneID: 102053935
NCBI-ProteinID: XP_027663161
Position
Unknown
AA seq 251 aa AA seqDB search
MCMHKQACPTTVTLACWSLAAASSIQGRRHNTGSWQPPARSHGVLLAPQVKCYGSVQGTI
YDYGALTIDGDEYVPFRNYAGKMVLFVNVATYUGLTLQYLELNALQNELGPYGLVVLGFP
SNQFGKQEPGQNSEILPALKYVRPGGGFVPNFQLFQKGDVNGAKEQKVYTFLKNACPPVA
EEFGNPKNLFWEPLRNHDIKWNFEKFLVGPDGVPVMRWYHRANIAVVKNDIIAYMREQQQ
QQQQQQQQEEQ
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtgcatgcacaagcaagcctgtcccaccaccgtgaccttggcgtgctggagtctggct
gctgccagcagcattcagggcaggaggcacaacactggcagctggcagcccccagcccgg
tcccatggggtgctccttgctccacaggtgaaatgctacggctcagtgcagggcaccatc
tatgactacggggccctgaccatcgatggggacgagtatgtcccgtttaggaactacgca
gggaagatggtgctcttcgtcaacgtggccacgtactgaggcctcaccctgcagtacctt
gaactgaatgcactacaaaatgagctggggccctacgggcttgtcgtcctgggcttcccc
tccaaccaatttgggaagcaggaacctggccaaaattcggagatcctccctgcgctgaag
tatgtccggccagggggtggttttgtccccaacttccagctcttccagaaaggggacgtg
aatggggccaaggagcagaaagtctacaccttcctgaagaacgcctgtcctccagtggca
gaggagtttgggaaccccaagaacctcttctgggagcctctgcggaaccatgatatcaag
tggaactttgagaagttcctggtgggccccgatggcgtgcctgtcatgcgctggtaccac
cgtgccaacattgctgttgtgaagaacgacatcatcgcctacatgagggagcagcagcaa
cagcagcagcagcagcaacagcaggaggaacagtag

DBGET integrated database retrieval system