KEGG   Falco cherrug (Saker falcon): 102055141
Entry
102055141         CDS       T02911                                 

Gene name
MECOM
Definition
(RefSeq) MDS1 and EVI1 complex locus protein isoform X1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102055141 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fch03000]
    102055141 (MECOM)
Transcription factors [BR:fch03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    102055141 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-BED zf-C2H2_8 zf-C2H2_11 zinc_ribbon_15 PyrI_C
Other DBs
NCBI-GeneID: 102055141
NCBI-ProteinID: XP_027662467
Position
Unknown
AA seq 1055 aa
MKSEDYSHETMAPDIHEERQYRCEDCDQLFESKAELVDHQKFPCSTPHSAFSMVEEDFQK
KLENENDLQDVHEIQECKECDQVFPDLQSLEKHMLSHSEEREYKCDQCPKAFNWKSNLIR
HQMSHDSGKHYECENCAKQVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHK
HIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFC
EGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMNHANPGLADYFGANRHPAGLTFPTAPGF
SFSFPGLFPSGLYHRPPLLPTSSPVKGLPSADQTNKSQSPLMTNPQILPATQDILKALNK
QPSVGENKPVELQPERSSEERPHEKLSDQSESSDLDLDDVSTPSGSDLETTSGSDLESDI
ESEKEKFKENGKMFKDKVSSLQSLASINNKKDHSNHSIFSPSLEEQTAVSGAVNDSIKAI
ASIAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRPLPLKVEPQ
SPSEIKKIPKGSSESPFDLTIKRKEEKPLTPIPSKPAAPSAASQDQPLDLSMGSRSRASG
TKQAEPRKNHVFGEKKGGDLEQRKASESSLQHARPTPFFMDPIYRVEKRKLTDPLEALKE
KYLRPSPGFLFHPQFQLPDQRIWMSAIENMAEKLESFSALKPEANELIQSVPSMFNFRAP
PSALPETLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQ
RHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELESTGAILD
DKEDSYFTEIRNFIGNSNHNNQSPRNSEERMNGSHFKDEKAMVASQNSDLLDDEEAEDEV
MMDEEDEESEIAGKTVKEPVTSDMHEGTPEEDYEETSTLDMNCKASPGRYKEEEYNKTGL
SALDHIRHFTDSLKMRKMEENQYSEAELAAFNTSQLPEDLKQPLYRKSKSQAYAMMLSLS
DKDSLHSASHNSPNMWHSMARAAAESSAIQSISHV
NT seq 3168 nt   +upstreamnt  +downstreamnt
atgaagagtgaagattattcacatgaaacaatggctccagacattcacgaggagcgccag
tatcgctgcgaggactgcgaccagctctttgagtccaaggctgagcttgtagaccaccag
aagttcccctgcagcacccctcactccgccttctccatggtggaggaggacttccagaaa
aagcttgagaatgagaatgaccttcaggatgtacatgaaatccaggagtgtaaggagtgt
gatcaagtcttcccagacttacaaagcctggagaagcacatgctgtcacacagcgaggag
agggagtacaagtgtgaccagtgccccaaagcttttaactggaagtccaacttgatacgc
caccaaatgtcgcacgatagcgggaagcactacgagtgtgaaaactgtgccaagcaggtt
ttcacggaccccagcaaccttcagaggcatattcgttcccagcatgttggggctcgtgct
cacgcttgtccagagtgtggcaaaacctttgccacttcttcaggcctcaaacagcataaa
cacatccacagcagtgtcaaaccttttatatgtgaggtctgccataaatcctatactcag
ttttcaaacctttgtcgtcataagcgcatgcatgctgattgcagaacccaaatcaagtgc
aaagactgtggacaaatgttcagcactacgtcttccttaaataaacacaggagattttgt
gagggcaagaaccattttgcagcaggaggattttttggccaaggcatttcacttcctgga
accccagctatggataaaacgtccatggttaatatgaatcatgcaaatccgggccttgct
gactattttggagccaataggcatcctgctggtcttacctttccaacagctcctggattt
tcttttagcttccctggtctgtttccttcaggcttgtaccacaggccacctttgctacct
actagttctcctgttaaaggactaccgagcgcagatcagacaaacaaaagtcaaagtccc
ctcatgacaaatcctcagatactgccagccacccaggatattttgaaggcactaaataag
caaccatcagtaggggagaataagccagtggagcttcaaccagagaggtcctctgaagag
aggccgcatgagaaactcagtgaccagtcagagagtagtgaccttgaccttgacgatgtc
agtacccccagtggcagtgacctggaaaccacctcgggctctgatctggaaagtgacatt
gaaagtgagaaagagaaatttaaagaaaatggtaaaatgttcaaagacaaagtaagctct
ctgcagagcctggcttcaataaataataagaaagaccacagcaatcattccattttctca
ccatccttagaggagcagactgcggtgtcaggagcggtgaatgattctataaaggctatt
gcttctattgctgaaaagtactttggttcaacaggacttgtggggctgcaagacaaaaaa
gtcggagccttaccttacccttccatgtttcccctcccattttttccagcattctctcaa
tcaatgtatccatttcctgatagagacttgagaccgttacccttgaaagtggagccccaa
tcacccagtgaaataaagaagattccaaagggaagctctgagtctccctttgacctcacc
ataaagcgtaaggaggagaagccacttactcccataccctcaaagccagcagccccctct
gcggcaagccaggaccagcctctagatctcagcatgggcagcagaagtcgagccagtggc
acaaaacaagccgagcctcggaaaaaccacgtctttggagaaaagaaaggaggtgacctc
gagcaaaggaaagcttcggagtcctccttgcagcacgccaggcccaccccattctttatg
gatcccatttacagagtagaaaaaagaaagttaactgacccactggaagctttaaaagag
aaatacttgagaccttccccaggattcttgtttcatccacaattccaattgcctgatcaa
agaatttggatgtcagctatagaaaacatggccgaaaagctggagagcttcagtgccctg
aaaccggaggccaacgagctgatccagtcggtgccgtccatgttcaacttccgcgcgccg
ccgagtgccctgcccgagaccctgctgcgcaagggcaaggagcgctacacctgcagatac
tgtggcaagattttcccgagatctgcaaacctaacacgtcacctgaggacgcacactgga
gagcagccctatagatgcaaatactgtgacagatcctttagcatatcttctaacctgcag
agacatgtccgtaacatccacaataaagagaagccattcaagtgtcacttgtgtgacagg
tgttttggtcaacaaaccaatcttgacagacatctaaaaaagcacgagaacgggaacatg
tctggtactgcaacgtcttcacctcactcagaactggaaagcacaggggcaatcctagac
gacaaggaagactcttacttcacagaaattaggaattttattggaaacagcaaccacaac
aatcagtccccccgaaactcagaggagagaatgaatggcagccactttaaggatgaaaaa
gccatggtagccagccagaactcagatttgctggatgacgaggaggcagaagatgaagtc
atgatggacgaagaagatgaagagagtgaaattgcagggaaaacagtcaaagagcctgtt
acaagtgacatgcatgaggggactccagaggaggattacgaggaaacgagtactttggac
atgaactgcaaagcttcccctggcaggtataaagaggaggagtataataagactggactt
tcggctttggaccacataaggcacttcacagatagcctcaaaatgaggaaaatggaagaa
aatcaatatagtgaagctgaattggcagctttcaatacttcccagctgccagaggaccta
aaacagccgttgtacaggaaatccaaatcccaggcgtatgcgatgatgctttctctctca
gacaaggactcccttcattctgcatcccacaattctcccaatatgtggcacagtatggcg
agagctgctgcagaatccagtgccattcaatccatcagtcacgtatga

DBGET integrated database retrieval system